(data stored in ACNUC7421 zone)

EMBL: CP002355.PE448

CP002355.PE448       Location/Qualifiers
FT   CDS_pept        435866..437632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0449"
FT                   /product="sulfate thiol esterase SoxB"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterProIPR006311:
FT                   IPR008334: IPR006179: IPR006146: IPR 017909; KEGG:
FT                   tdn:Suden_0264 sulfate thiol esterase SoxB; PFAM:
FT                   5'-Nucleotidase domain-containing protein; SPTR: Sulfate
FT                   thiol esterase SoxB; PFAM: 5'-nucleotidase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33116"
FT                   /db_xref="GOA:E4TZM8"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM8"
FT                   /protein_id="ADR33116.1"
FT                   /translation="MDLSRRDFFHIAAALGLGAPALASAASGPKRVDEVGLKDIYSFNA
FT                   RGNVTLLHICDMHAHLKPLYWREPSTLISAPNLTGTPGFLCGESFLKHYGMKGKSLDAY
FT                   FDTYMNFDAMAHKFGKMGGIAHMKTLINHIKKERGADNVMLLDSGDTWQGTGVALKTKG
FT                   EAIVKAQNYLGVDVMVGHWEFTYGKTRVKELIEMLNAKFVSQNIIGDDSFADDFEELIF
FT                   EPYTIMERGGAKIGIIGQSFPFTSTANPKEFTQGWSFGLRLDTLQTYVDKLRKEEKVDC
FT                   VVVLSHDGFSVDQEVARQVKGIDFILSGHTHDPSPQPTVINGTVIVIAGSHGKYIGRLD
FT                   IDIKNHKVKGYEYKLIPVAANLIPADPEGEALVKELYSPYDSELSEVLGITKNTLFKRD
FT                   TFHSTFDQLINDSIIDAMDSDISFTPGYRWGTTVLEGDAITMDHVYDMTAITYPNVYTF
FT                   ELTGKHIRTLLEDIADNVFNANPLYQQGGDMSRLGGVTYEIRVGAASGKRITNIMVGGK
FT                   PLSDTKVYKVSSWGGNLQNAGSNLKENLTRPVYDVTSAYIRRQKNVNISGNSNVRLVDY
FT                   DCGCPKKGAKGC"
     atggatttat cgcgaagaga tttttttcac attgccgctg ctttggggtt aggagctccg        60
     gcattggcat ccgctgcttc ggggccaaaa agggttgatg aggtcggatt aaaagacatt       120
     tattctttta atgcacgggg caacgtgaca ttgttgcata tctgtgacat gcatgcccac       180
     ctcaagccgc tttactggcg tgagccatcg acattgattt cagcgccgaa tttgaccgga       240
     acaccgggat ttttgtgcgg tgagtcgttt ttgaaacatt acgggatgaa gggcaaaagt       300
     ctggatgcct attttgacac gtatatgaat tttgacgcaa tggcgcacaa attcgggaaa       360
     atggggggga tcgcccatat gaaaaccctc atcaaccaca ttaaaaaaga gcgcggtgcc       420
     gataatgtca tgctcctcga ttcgggggat acatggcagg ggaccggcgt tgcgttgaaa       480
     accaaaggtg aagcgatcgt caaagcacaa aattacctcg gtgtcgacgt aatggtcggt       540
     cactgggaat ttacctacgg taaaacacgg gtcaaagagc ttatcgaaat gctcaatgct       600
     aaattcgtct ctcaaaatat tatcggtgac gattcgtttg ccgatgattt cgaagagctg       660
     attttcgagc cgtataccat tatggagcgc ggcggtgcga aaatcggtat tatcggtcag       720
     tcgttcccgt tcacctctac ggcgaacccg aaagagttta cccaaggatg gagcttcggc       780
     ctaaggctgg atacccttca aacgtatgtc gataaacttc gtaaagaaga aaaagtggac       840
     tgtgtcgttg tcctttccca tgacggtttc agcgttgacc aagaggttgc gcgccaggtc       900
     aaagggatcg actttatcct cagcggccat acgcatgacc cgtcaccgca gccgaccgtt       960
     attaacggta cggtgatcgt gattgccgga agccacggta aatatatcgg acggcttgat      1020
     atcgatatta aaaaccataa ggtaaaggga tacgagtata agcttatccc tgttgcggcg      1080
     aacttgattc cggccgaccc tgagggcgaa gctttggtta aagagctcta ttcaccatat      1140
     gattccgaac tttccgaagt tttgggaatt actaaaaata cgctgtttaa acgcgacacg      1200
     ttccattcaa cgttcgatca gttgatcaat gactctatta tcgatgcgat ggattccgac      1260
     atctctttta caccgggata ccgctgggga actacggtac ttgaagggga tgcgattacg      1320
     atggatcatg tttatgatat gaccgcgatt acctatccga acgtttatac gttcgagttg      1380
     accggaaaac atatccgtac gttgcttgag gatattgccg ataacgtatt taacgccaat      1440
     ccgctttatc aacaaggagg cgatatgagc cgtttgggcg gtgttacgta tgaaattcgt      1500
     gtcggtgccg ccagcggtaa acgtattacg aatattatgg taggcggtaa accgctcagt      1560
     gacacaaaag tgtacaaagt atcatcatgg ggaggaaatt tgcaaaacgc cgggtcaaat      1620
     ttaaaagaaa acttaacccg tcccgtgtat gatgtcacgt cagcctatat ccgtcgtcag      1680
     aaaaacgtca atatcagcgg aaacagcaat gtccggttgg tagattatga ttgcggatgt      1740
     ccgaaaaaag gtgcgaaagg gtgctaa                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page