(data stored in ACNUC7421 zone)

EMBL: CP002355.PE449

CP002355.PE449       Location/Qualifiers
FT   CDS_pept        437673..439163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0450"
FT                   /product="outer membrane porin"
FT                   /note="InterPro IPR005318; KEGG: tdn:Suden_0265
FT                   hypothetical protein; PFAM: outer membrane porin; SPTR:
FT                   Putative uncharacterized protein; PFAM: outer membrane
FT                   porin, OprD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33117"
FT                   /db_xref="GOA:E4TZM9"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM9"
FT                   /protein_id="ADR33117.1"
FT                   /translation="MNIMKISMAAAAACLLATSAHALKTEDRDLKGNNIVEYTKAPGDV
FT                   NSIKEMFTEGKVYGRLRSNTFWYNSDNEKSTLQDHNVWGLGGSLVYKTGFFHGFGATAG
FT                   FYGSVPLGSPNVPEGSTTNYGKQGKDIYRTRSDGTEAAMGVVAQAYGEYKISKSNIKLG
FT                   RQMIESTLLSSNDTKMIPNTFTAAVAETKDIKDTTLRAGYITSEKLRNHQEFHSILAYA
FT                   SLTENDDAATHKGLKIANITRAGEDKDPEMVLVTAENKSIPGLKLEGEYYGINGYFSTV
FT                   IAEANYKIGLGNDWTLTPGVRYLRQMDDGAGAIGGASLSGKAATTVNGGTTAGRAAYSD
FT                   ASSVDASMWAARLVAAKGPLELQVGYSKIADDADLITPWRGFPTGGYTRSMGQVDWIAN
FT                   TKNWALKATYDFDKAGLVPGLKISADYENMNFDDSKAATTGFTDRDIIHLDAWQTFKSL
FT                   PNTEFKFRFATIDADPAVGATTDYNSYDEYRFEINYLF"
     atgaacataa tgaaaatcag tatggcggca gcagctgcat gtctacttgc aacgtcggcg        60
     cacgcgctta aaacagaaga tcgtgatctc aaagggaata atattgtcga gtatacaaaa       120
     gcgccgggtg atgtaaactc aatcaaagag atgtttacag aggggaaagt ttacggacgt       180
     ctccgctcaa atacgttttg gtacaattct gataatgaaa aaagtactct gcaagatcat       240
     aatgtttggg gtctaggcgg aagtttggtt tataaaaccg gttttttcca tggtttcgga       300
     gcaacggcag gtttctacgg aagcgttccg ctaggatcac ctaatgttcc ggaaggctca       360
     acaacaaact acggtaaaca aggaaaagac atttatcgta cacgtagtga cggtacggaa       420
     gcagctatgg gtgtagtagc ccaagcgtac ggggaatata aaatctcgaa aagtaacata       480
     aaattgggtc gacagatgat cgaaagtacc cttctttcgt cgaatgatac gaaaatgatt       540
     ccgaatacat ttacggcggc agttgcggaa acgaaagata ttaaagatac gacattacgt       600
     gcagggtaca ttaccagtga aaaattgaga aaccaccaag aattccatag tattttggcg       660
     tatgcgtcat tgacggaaaa tgatgatgct gctacacaca aagggcttaa aattgccaat       720
     atcacaagag caggagaaga taaagatcct gaaatggtac ttgtaacggc tgaaaacaaa       780
     tctattccgg gattaaaact tgagggcgaa tattacggaa tcaacggtta tttctccacg       840
     gttattgccg aagcaaatta taaaattgga ttaggtaatg attggacgtt gacaccgggt       900
     gttcgctatc ttcgtcaaat ggatgacggt gccggtgcga tcggtggagc atctttgagc       960
     ggaaaagcgg caacgaccgt aaatggtggt acgactgcgg gacgtgcggc gtatagcgat      1020
     gctagcagtg tcgatgcgag tatgtgggcg gcgcgcttgg tagcggcaaa aggtcctctt      1080
     gaactacagg tgggatattc taaaattgct gatgatgccg acctcataac tccgtggcgt      1140
     ggattcccga cgggcggata tacccgatca atgggacagg ttgattggat cgcgaacact      1200
     aaaaactggg cgctaaaagc aacatatgat ttcgacaaag cgggtcttgt ccctggattg      1260
     aaaatttcag ctgattatga aaacatgaat tttgatgatt caaaagcggc aactaccggt      1320
     tttaccgatc gtgatattat ccatctcgat gcatggcaaa cgtttaaatc acttccgaat      1380
     acggagttca aattccgttt tgcaaccatc gatgctgatc cggcggtagg tgctacaacc      1440
     gattacaact catacgacga ataccgtttc gaaatcaact acctcttcta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page