(data stored in ACNUC7421 zone)

EMBL: CP002355.PE450

CP002355.PE450       Location/Qualifiers
FT   CDS_pept        439174..440079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0451"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: nis:NIS_0439 hypothetical protein; SPTR:
FT                   Metallo-beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33118"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN0"
FT                   /protein_id="ADR33118.1"
FT                   /translation="MKTLLVSFFFAVTSLSAYDYALKPVRVSEDIHCFFGKPEIMDKTN
FT                   NGNIVNSCYIDAKEGYVVVDTGPSYAYAESAYKAMKKIKSLPVKLVINTHIHDDHWLGN
FT                   NYFTEQGIRVVGTDDFKVNADMSVPSRMQTHISADAYSKTVPTMPSEMINSDTTLKIGN
FT                   QTLELKIAKRKAHTAKDMVVFLPKSKVLIAADLVFNDRLPSVRGGDINGWLSALEDLDK
FT                   LDAVHVVGGHGNRTDKDAARMTREYFTQMRTEIRAAIADGLGIDDTIKKVSMDKYKKYK
FT                   LYEETHRHNVESSYRVLEWE"
     atgaaaacgt tgttggtctc ttttttcttt gctgtcacga gcttaagtgc gtatgattac        60
     gcacttaagc ctgtacgcgt gagtgaagat atccattgct tcttcggcaa accggagatt       120
     atggataaaa ccaacaacgg caacatcgtc aatagctgtt acatcgatgc gaaagagggg       180
     tacgtggtcg tcgatacagg tccctcatac gcatacgccg agtctgccta caaagcgatg       240
     aaaaaaatca aatccctccc cgttaaactt gttataaaca cccatatcca tgatgatcat       300
     tggctgggga acaactattt taccgagcag ggaatccgtg ttgtagggac cgatgatttc       360
     aaagtcaacg ccgatatgag tgttccgagc cgtatgcaaa ctcatatttc ggctgatgct       420
     tactccaaga ccgtccctac gatgccgagt gagatgatca acagtgatac gaccctcaaa       480
     atcggtaatc aaacgctgga actcaaaatt gccaaacgca aagcccatac ggcgaaagac       540
     atggtggtgt ttttacctaa atccaaagtg ttgattgccg ccgatttggt gtttaacgac       600
     cgtctcccct ccgttcgcgg cggggatatc aacgggtggc tctctgcttt ggaggatctg       660
     gataaactgg acgcggtaca tgtcgtcgga gggcatggca atcgaaccga taaagatgcg       720
     gctcgtatga cacgggagta ttttacgcag atgcggacag aaattcgtgc cgcaattgcc       780
     gatggattgg gtatagatga cacgattaaa aaggtcagta tggataagta taaaaagtat       840
     aaactgtatg aggagacgca tcgtcataat gtcgaatctt cgtaccgggt actggaatgg       900
     gagtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page