(data stored in ACNUC7421 zone)

EMBL: CP002355.PE451

CP002355.PE451       Location/Qualifiers
FT   CDS_pept        440082..440516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0452"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1416 conserved hypothetical protein; KEGG:
FT                   nis:NIS_1825 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33119"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN1"
FT                   /protein_id="ADR33119.1"
FT                   /translation="MKRLLMVLGLVSTLAYGDIRFAQPEPSIEKPREVVMGISHGDDES
FT                   IHHGLSTANNVLKFYGPEKIHLRIVAYYHGIRTLLKSEKEIAVRVRALQQYGVEFVACG
FT                   NTMETKKITPDQLDDDVEIVSAGIAEVIERATEGAFYIQP"
     atgaaacgac tgctaatggt tttgggtttg gtttccaccc ttgcgtatgg ggatattcgt        60
     tttgcacagc ccgaaccttc tattgaaaaa ccgcgcgagg ttgtgatggg aattagccat       120
     ggcgatgatg aatcgatcca tcacggtctt agtacggcaa ataatgttct taaattttat       180
     ggtccggaga agattcattt acggatcgtc gcgtattatc acgggatacg cactttactg       240
     aaaagcgaaa aagagattgc ggtacgagta cgtgccttgc agcaatacgg tgtcgagttt       300
     gtcgcgtgcg gcaatacgat ggagaccaaa aaaatcacac ccgatcagct cgatgatgat       360
     gtcgaaatcg tcagtgcggg aatcgccgaa gtgatcgaac gcgccactga aggcgcattt       420
     tacattcaac cttag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page