(data stored in ACNUC7421 zone)

EMBL: CP002355.PE452

CP002355.PE452       Location/Qualifiers
FT   CDS_pept        440526..441425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0268 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33120"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN2"
FT                   /protein_id="ADR33120.1"
FT                   /translation="MKILLVTILAGFLSLFGGDLHLFSVSNADGKYNASVIEKALEANG
FT                   FVISANSEMNGPFKIQFGQSDFSQFNLLTAYHKAHSEALVKANPDAGIFVPMGFGIYQR
FT                   NGDKNLHVSILTAKSMEKIAGFKAKEFALIEKEAIATLKKALSGAKITQSETSLPAEGK
FT                   LLSRFVKASSKESWASDKEETEMMIEDGLKPAGFVMSNFTDYNFALGQKSPFDFYDTYS
FT                   ICKLKVIYTVAKTRPEAAAFAPCTLMVYKKKDADEIVMGFPGVYNWMSSARVDNLEAKE
FT                   TLLQAQKDFEGVLKSVIE"
     atgaaaattc tacttgtaac tattttagcg gggtttttat cccttttcgg cggtgatttg        60
     catcttttta gtgtctcaaa tgcggatggg aaatacaatg catccgttat agaaaaagca       120
     ttggaagcca acggctttgt catttcggct aacagtgaaa tgaacgggcc gtttaaaatt       180
     caattcggac aaagtgattt ttcacaattc aaccttttaa ccgcgtatca caaagcccat       240
     tcggaagcat tagtgaaagc aaatcctgat gccgggatct ttgttccgat gggatttgga       300
     atctaccaac gtaacggaga caaaaatctt catgtctcta ttctaaccgc aaagtcgatg       360
     gaaaaaatcg ccgggtttaa ggccaaagag tttgctttga tcgaaaaaga ggcgattgct       420
     actctcaaaa aagcgctgtc gggtgccaaa ataactcaga gtgaaacctc tctccctgct       480
     gaggggaaac ttttaagccg atttgtcaaa gcaagcagca aagagagttg ggcaagcgac       540
     aaagaagaga cggagatgat gatcgaagac ggccttaaac cggcaggatt tgtgatgtcg       600
     aattttaccg attacaactt tgcgctcggt caaaaaagcc cgtttgattt ttacgatacc       660
     tattctatct gtaaactcaa agtaatttat acggtagcca agacacgtcc ggaagcagcg       720
     gcatttgccc cgtgtacatt gatggtatat aagaaaaaag atgccgatga aatcgtaatg       780
     ggcttcccgg gagtctataa ctggatgagc agtgcacgtg tcgataactt agaggcaaaa       840
     gagacgttac ttcaggctca gaaagatttt gagggagttt taaaaagcgt catcgagtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page