(data stored in ACNUC7421 zone)

EMBL: CP002355.PE453

CP002355.PE453       Location/Qualifiers
FT   CDS_pept        441479..442411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0454"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667: IPR003156; KEGG: abu:Abu_2037
FT                   exopolyphosphatase-related protein; PFAM: phosphoesterase
FT                   RecJ domain protein; phosphoesterase DHHA1; SPTR:
FT                   Exopolyphosphatase-related protein; PFAM: DHH family; DHHA1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33121"
FT                   /db_xref="GOA:E4TZN3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN3"
FT                   /protein_id="ADR33121.1"
FT                   /translation="MPLSLIDSADHIVLVAHKNPDADSLGAACAFYSYLLRSQKKITLF
FT                   CASSAVNPNLAFLPWFEKITDRFPDNADCIISFDCGSYGRLGIEKELPLINIDHHASND
FT                   FYGTHNLVNTHAISTTEVLYDYFVANGIKINGKMALSLYAGLLDDSKCFSASECSAKTF
FT                   SMAHALIELGADHAVCTEWLYRRGSLASLRVRGSLFKQMKLVLDGQLAVFEIPFVLLEE
FT                   TGASVAECKSAMDEALGMRSVKAALMVVHFPGKGIKLSLRTNGTVNAAAIMAEFGGGGH
FT                   VKRAGTYLKQENYDELIQTMMVKITKELV"
     atgcctttat ccctgattga ttccgccgac catatcgttt tggtagcaca taaaaatccc        60
     gatgccgatt cgctcggtgc ggcgtgtgct ttttactcct atttacttcg gagccaaaag       120
     aaaataaccc ttttttgtgc ttcatccgca gtcaatccca atctcgcttt tttgccgtgg       180
     tttgagaaaa taaccgaccg ttttcctgac aatgccgact gtatcatcag ctttgactgc       240
     ggaagctacg gccgtctagg gattgagaaa gagctgccgc ttatcaatat tgaccaccat       300
     gcgagtaacg atttttacgg tacccacaat cttgttaata cacatgcgat aagtaccacc       360
     gaagtactgt acgattattt tgttgccaac ggtataaaaa tcaatggtaa aatggcactt       420
     tcgctttacg cgggactgct cgatgattct aaatgtttta gcgcttccga atgcagtgcc       480
     aaaacatttt cgatggcaca cgctttgata gagctgggtg ctgaccatgc ggtatgtacg       540
     gaatggctgt atcgtcgagg ttcgcttgct tcattgcggg tacgcggaag tctctttaag       600
     cagatgaaac ttgtgcttga tgggcaattg gctgtatttg aaatcccttt tgtattattg       660
     gaagagactg gagccagtgt agccgagtgc aagagtgcta tggatgaagc actgggaatg       720
     cgcagtgtta aagccgcatt gatggttgtc cattttcccg gcaaggggat aaagctctcg       780
     ctacgaacca acggtaccgt aaatgctgcg gcaattatgg cggaattcgg cggaggcggg       840
     catgttaagc gtgccggaac gtatctaaaa caagaaaatt atgatgagct gatccaaacg       900
     atgatggtga agataacaaa ggagttggtg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page