(data stored in ACNUC7421 zone)

EMBL: CP002355.PE454

CP002355.PE454       Location/Qualifiers
FT   CDS_pept        442408..443778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0455"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   tdn:Suden_0671 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33122"
FT                   /db_xref="GOA:E4TZN4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN4"
FT                   /protein_id="ADR33122.1"
FT                   /translation="MRRGRKNSGIVGWILVAAVLAALGFMAFSPVFERDDPKVTLSQEG
FT                   YWNFQDPIHVNVEDVSGLKSYKATISTPHDEWVVVDENNPSHEIKKSFDIRPPKGVRRV
FT                   DSNSIVLKIEATDNSLWGLFMGNTFKQEYTLVIDQRRPVLSIIANSYKIQKGGSAIVIF
FT                   KAEDANLESLKIQTNFGKTFIAQPFMKEGYYASLVAWPVQEASFSATVVARDKAGNEVR
FT                   NAIPLRLKDHVYRVSNIELSDQFLDGKIAELANTYEQTAGVDDRLEQFRIINEKVRADN
FT                   EKIIHGITSKVSKNMITDFNPVPFYPLVNGQKVADFGDHRIYSYKGQENVSQAYHMGLD
FT                   LASVAMGPITSSNGGKVVFSQPNGIYGNLPIIDHGFGLYTLYGHCSEVHVQEGDTAAIA
FT                   QEIAKTGLSGYAMGDHLHFGILVQGIEVRPEEWMDSKWIADNITSVIDNAKAIINQH"
     gtgagaagag gccgaaagaa ttcgggaata gtcggatgga tattagtagc agcggttttg        60
     gccgctttag gatttatggc attttcgccg gtgtttgaac gggatgatcc gaaagtgacc       120
     cttagtcaag aggggtattg gaattttcaa gatcctattc atgtcaatgt ggaagatgta       180
     agcggattaa aatcttacaa agcgacgatt tcaacgcctc acgacgagtg ggtcgttgtg       240
     gatgaaaata atccgtcgca tgagataaaa aaatcatttg atatccgtcc gccaaaaggg       300
     gtacgcagag tagattcaaa ttcgattgtt ttaaaaatcg aagcaacgga taacagcttg       360
     tggggccttt ttatggggaa cacttttaaa caagagtata cccttgtgat cgatcagcgc       420
     cgtccggtcc tctctatcat tgcaaactcg tataaaattc aaaaaggggg atcggcaatt       480
     gtcattttta aagcggaaga cgccaatttg gagagcctga aaattcaaac caattttggg       540
     aaaacgttta ttgcccaacc gtttatgaaa gagggatatt acgcttcact ggttgcatgg       600
     ccggtacagg aagcttcgtt ttccgcaacg gtcgtagcac gtgataaagc gggaaatgaa       660
     gtgcgaaatg ctattccttt acgcctcaaa gaccatgttt accgtgtttc caatatcgaa       720
     ctcagcgatc agttcttgga cggtaaaatt gccgaactgg caaacaccta tgaacagacg       780
     gcgggggtgg atgaccggtt ggaacagttt cgaattatca acgaaaaagt acgtgccgat       840
     aatgaaaaaa ttatccatgg gattacctcg aaagtatcca agaacatgat tacggacttt       900
     aatcccgtac cgttttatcc gttggtaaac ggccaaaaag tagccgattt cggagatcac       960
     cgtatttata gctataaagg gcaggaaaac gtctctcaag cctaccatat gggattggat      1020
     ctcgcaagtg tcgcgatggg gccgataaca tcgtccaacg gcgggaaagt ggtgttttca      1080
     caacctaacg ggatttacgg aaatctgccg atcattgatc acggattcgg attgtatacc      1140
     ctttatggcc actgttcgga agttcatgtg caggaggggg ataccgccgc aatagcacaa      1200
     gaaatagcaa aaaccggatt aagcggttac gcgatgggag atcaccttca tttcggaatt      1260
     ttggttcagg ggattgaagt acgtcccgaa gagtggatgg acagcaagtg gatagccgat      1320
     aacatcacca gcgttatcga taacgccaag gctattatta accaacactg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page