(data stored in ACNUC7421 zone)

EMBL: CP002355.PE456

CP002355.PE456       Location/Qualifiers
FT   CDS_pept        444705..445157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0673 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33124"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN6"
FT                   /protein_id="ADR33124.1"
FT                   /translation="MHDALVIALSSPILIGIYKDGVLVEEIREDGMSSDVLAEIFESLL
FT                   KRYTFRTFIYAKGPGSFMGIKVTYLFLKTLSITLKIPLLATDAFFFNQNSPIKAVGKLY
FT                   FVKNRTTIELEPIESPELIAFSLPENIDLKKFDSDTLPYYGIDAVG"
     atgcatgacg cactcgtcat tgcactgagc tctcccatcc ttatcggcat ctacaaggat        60
     ggcgttttgg tcgaagagat tagagaggac ggaatgagct cggatgttct ggcggagatt       120
     ttcgagtcat tgctgaaacg ttatacgttt agaacgttta tatacgccaa aggtcccgga       180
     agttttatgg ggatcaaagt tacttacttg ttcctcaaaa cgttaagcat tacgttaaaa       240
     atcccccttt tggcaacaga tgctttcttt tttaaccaaa atagccccat caaagcagtt       300
     ggaaagctct attttgttaa aaataggaca acaattgagc tggaaccgat cgaatcacct       360
     gagttgatcg cttttagtct tcccgaaaat atcgatttaa aaaaatttga ttcggacact       420
     ctcccttatt atgggataga tgccgtagga taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page