(data stored in ACNUC7421 zone)

EMBL: CP002355.PE457

CP002355.PE457       Location/Qualifiers
FT   CDS_pept        445167..446048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0458"
FT                   /product="homoserine kinase"
FT                   /note="COGs: COG0083 Homoserine kinase; InterPro IPR000870:
FT                   IPR006204: IPR006203; KEGG: tdn:Suden_0674 homoserine
FT                   kinase; PFAM: GHMP kinase; SPTR: Homoserine kinase;
FT                   TIGRFAM: homoserine kinase; PFAM: GHMP kinases C terminal;
FT                   GHMP kinases N terminal domain; TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33125"
FT                   /db_xref="GOA:E4TZN7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN7"
FT                   /protein_id="ADR33125.1"
FT                   /translation="MFVSVPATSANLGPGFDSLGLAVDLRNQVELVPSRFFAVSIKGEG
FT                   ENNPRLKGNNLFVSIFNEHYRRLTQKRQNFKFTFYNQIPMSRGLGSSSAVIVSAISCAH
FT                   EAAGVKVSKRRILNHALVYESHPDNITPAVMGGFNAAMVEKQKVFSQQKHLPDYLKAVV
FT                   VIPNKPISTAKSRTTLPKSYSKENAVFNLSHTAVTVGAFFNEDWEMLRLATQDRFHQKV
FT                   RMKMLPELFAVQKMAYDNGALMSTLSGSGSTFFNMVYDQDAKMLADKFKAEFSDFEIKI
FT                   LGFDNDGLVVER"
     ttgttcgtta gtgtacccgc aacgagtgct aatttaggac ccggatttga ttcattggga        60
     cttgccgttg atcttcgtaa ccaggtagaa ttggttccgt cacgattttt tgccgtttcc       120
     attaaagggg agggggagaa taatccccgt ctcaaaggga acaatctgtt cgtcagtatc       180
     ttcaacgaac attatcgccg cctcacccaa aaacggcaaa atttcaaatt tacgttttac       240
     aaccaaatac cgatgtctcg cgggctagga agctcatctg ccgtcatcgt cagtgccata       300
     agctgtgctc atgaagccgc aggggtcaaa gtctcaaaac gccgtatcct caatcatgct       360
     ttggtttatg agtcccatcc cgataatatt actccggcgg tcatgggggg atttaatgcg       420
     gcaatggtag agaaacaaaa ggtattttca cagcaaaaac accttcccga ttatctcaag       480
     gcggtcgtcg ttatcccgaa taagccgatc tcaaccgcga aatcacgtac aacccttcca       540
     aagtcgtaca gcaaagagaa tgcggtattc aacctttccc acactgcggt aacggttgga       600
     gcatttttta acgaagactg ggagatgctc cgtttggcta cccaagaccg gttccatcaa       660
     aaagtacgga tgaaaatgtt gcctgaactg tttgccgttc aaaaaatggc gtacgacaac       720
     ggtgctttga tgtctactct ctcagggagc ggatcgactt ttttcaatat ggtgtatgac       780
     caggatgcca aaatgttggc cgataaattc aaagcggaat ttagtgattt cgagattaaa       840
     attttaggct ttgacaatga cggtttggtt gtcgaacgat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page