(data stored in ACNUC7421 zone)

EMBL: CP002355.PE458

CP002355.PE458       Location/Qualifiers
FT   CDS_pept        446069..446323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0459"
FT                   /product="protein of unknown function DUF448"
FT                   /note="InterPro IPR007393; KEGG: tdn:Suden_0675
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF448; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Protein of unknown function (DUF448)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33126"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN8"
FT                   /protein_id="ADR33126.1"
FT                   /translation="MAQKLHQPIRMCVVCRERFAQVGLLRLQCRNGKLEPYGKEGRSFY
FT                   MCRSCIEHKKTPGQLSRQCKSGATVELMNRLKEIIVNDG"
     atggcgcaaa agttacatca gcctatacgc atgtgcgtgg tttgtcgcga gcgctttgcg        60
     caagtcggac ttttgcgact tcaatgccga aacgggaagt tagagcccta cggcaaggaa       120
     ggaagaagtt tttatatgtg caggtcttgt atcgagcata agaaaactcc ggggcagttg       180
     tcccgtcaat gcaagagcgg tgcgacggta gagctaatga atcggttaaa ggagatcatc       240
     gttaatgatg gataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page