(data stored in ACNUC7421 zone)

EMBL: CP002355.PE46

CP002355.PE46        Location/Qualifiers
FT   CDS_pept        complement(44375..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0046"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro IPR020809:
FT                   IPR000941: IPR020811: IPR020810; KEGG: tdn:Suden_2001
FT                   phosphopyruvate hydratase; PFAM: Enolase-like; PRIAM:
FT                   Phosphopyruvate hydratase; SPTR: Enolase; TIGRFAM: enolase;
FT                   PFAM: Enolase, N-terminal domain; Enolase, C-terminal TIM
FT                   barrel domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32714"
FT                   /db_xref="GOA:E4TW98"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW98"
FT                   /protein_id="ADR32714.1"
FT                   /translation="MIFIDEVSAIEVMDSRGNPTVKATVQLSDGTRESAVVPSGASTGK
FT                   REALELRDGDARYMGKGVLKAVENVNSQIADAIMGLSPFNQAMVDAAMKELDGTENYGN
FT                   LGANAVLGVSMAVARAAAKSLGIPLYRYLGGANAMVLPVPMLNIINGGSHADNSVDFQE
FT                   YMIMPIGFDDFSEGLRASSEVYHNLKTILKNRGANTALGDEGGFAPDLSSNEEPIQVIM
FT                   EAIAKAGYKAGEQIAIALDVAASELVTEGGYRLDSENRTVTSAQLVDYYVDLCSKYPIV
FT                   SIEDGLSEDDWDGWKLLTEKLGNKVQLVGDDLFVTNASILAEGIEKGIANAILIKPNQI
FT                   GSVSETMLTVRLAQRNGYKCVMSHRSGESEDAFIADFAVALNCGEIKTGSTARGERTAK
FT                   YNRLLEIETEVMYGEYLGSSLFN"
     atgattttta ttgatgaagt aagcgcgatc gaggttatgg attctcgcgg caatccaacc        60
     gtaaaagcaa cagtgcagtt aagtgacgga acacgtgaaa gcgcagtcgt tccaagcggt       120
     gccagtaccg gtaaacgtga agccctcgaa ttgcgcgacg gtgatgcgcg ttatatgggg       180
     aaaggggttc ttaaagcggt tgagaacgtc aatagccaga tcgccgatgc cattatggga       240
     ttaagcccgt ttaatcaggc aatggttgat gcggcaatga aagagctgga cggaacggaa       300
     aattacggca accttggtgc gaatgctgtt ttaggcgttt cgatggcggt tgcccgtgcg       360
     gcggctaaaa gtctcggaat cccgctttat cgctacctcg gcggtgccaa tgcgatggtc       420
     ttgccggttc cgatgctaaa cattatcaac ggcggcagcc acgccgataa cagcgttgat       480
     tttcaagagt acatgattat gccgatcggt tttgacgatt tttcggaagg gcttcgtgca       540
     tcgtctgaag tgtatcacaa tttaaaaacc atcctaaaaa atcgcggagc caatacggca       600
     cttggagatg agggcggttt tgcaccggat ttaagttcta atgaagagcc gattcaagtt       660
     atcatggaag cgattgccaa agcaggatac aaagcgggtg aacaaatcgc tatcgccctc       720
     gacgttgcgg catctgagct tgttaccgaa ggcggatacc gcctagattc agagaatcga       780
     accgttacct ctgcgcaatt ggttgattac tatgttgacc tatgctcaaa atacccgatt       840
     gtatccatcg aagacggctt gagtgaagac gactgggacg gatggaagct gttaactgag       900
     aaattgggca ataaagtgca gcttgtgggt gatgacctat tcgtaaccaa tgccagcatt       960
     ttggctgaag ggattgaaaa agggatcgct aacgcaattt tgatcaaacc gaatcaaatc      1020
     ggatcggttt ctgaaacgat gctgacggtt cgtcttgcac aacgtaacgg gtataaatgt      1080
     gtcatgtctc accgttcagg ggagagtgaa gatgcgttta tcgccgattt tgccgttgcc      1140
     ctaaactgcg gtgaaattaa aaccggttca accgcacgcg gtgagcgtac ggcaaaatac      1200
     aaccgtttgc ttgaaatcga aaccgaagtg atgtacggtg aatatttagg gagctctctc      1260
     tttaactaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page