(data stored in ACNUC7421 zone)

EMBL: CP002355.PE461

CP002355.PE461       Location/Qualifiers
FT   CDS_pept        449202..449633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0462"
FT                   /product="protein of unknown function DUF150"
FT                   /note="InterPro IPR003728: IPR020790; KEGG: abu:Abu_2045
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF150; SPTR: Ribosome maturation factor rimP; PFAM:
FT                   Uncharacterised BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33129"
FT                   /db_xref="GOA:E4TZP1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZP1"
FT                   /protein_id="ADR33129.1"
FT                   /translation="MSLESDIKKMVESIGLSLYDTAVFNENENTIFRVSVTAPGGVSLD
FT                   QCVEATHLISPLLDVTPPVGGEYRLEVSSPGIERKLKTLDHFAQSVGEKVVFSTVNKEK
FT                   FDGEVVSVENEEITIKTKEGETHTVPFRSISKAKTYFEW"
     atgagtcttg agagcgatat caaaaaaatg gtcgaatcga tcggcctctc tttatacgat        60
     acggctgttt tcaatgaaaa cgagaatacg atttttcgtg tgagcgttac cgcaccgggc       120
     ggagtgagtc tggatcagtg cgtcgaagcg acccatctta tctctccgtt actcgacgtt       180
     acccctcctg tcggcggcga ataccgtttg gaagtaagct cccctgggat cgaacgcaaa       240
     ctcaaaacac tcgatcattt tgcccaatcg gtcggcgaga aagtcgtttt ttcgaccgtg       300
     aacaaagaaa aattcgacgg tgaagtggtg tcggtcgaaa acgaagagat cacgataaaa       360
     accaaagagg gagagacgca caccgtccct ttccgctcta tcagcaaggc taaaacctac       420
     ttcgagtggt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page