(data stored in ACNUC7421 zone)

EMBL: CP002355.PE462

CP002355.PE462       Location/Qualifiers
FT   CDS_pept        449633..450643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0463"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /note="COGs: COG0117 Pyrimidine deaminase; InterPro
FT                   IPR004794: IPR002125: IPR002734; KEGG: tdn:Suden_0679
FT                   riboflavin biosynthesis protein RibD; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; bifunctional deaminase-reductase
FT                   domain protein; PRIAM:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   SPTR: Riboflavin biosynthesis protein RibD; TIGRFAM:
FT                   riboflavin biosynthesis protein RibD; PFAM: RibD C-terminal
FT                   domain; Cytidine and deoxycytidylate deaminase zinc-binding
FT                   region; TIGRFAM: riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33130"
FT                   /db_xref="GOA:E4TZW5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW5"
FT                   /protein_id="ADR33130.1"
FT                   /translation="MNTTAAIHAMTLALNAAWEYQLLTFPNPAVGAVCLSDNGTVVSVG
FT                   THKRAGGPHAEVYALRDAYTLLSGDTTIAGCDDSHRIHDYLRTRHNGIFHTVSMAVTLE
FT                   PCSHSGKTPSCALLIRDLGIKRVYISVKDPNPAAAGGASLLSDAGAECVFGIMEEEGEK
FT                   LLEPFIRWQKSPFVFFKWAQRLDGTIDNGTISSQSSREHMHALRDRCDLIVIGGNTVRH
FT                   DRPTLDARLVDGKAPDVLIYSQMGEFDQSIPLFSVPDRKVYVESSLERLKEYSLVMIEG
FT                   GTSMFQASQNTCDWYLCYLAPKLGGGLQNMGPIQEDFEVLHAKITDNILLWMKKK"
     atgaatacca ccgctgccat tcacgctatg accctcgctt taaatgcggc gtgggaatat        60
     caactcctca cttttcccaa tcccgccgtc ggtgccgtat gtctgagtga taacggtact       120
     gtcgtctctg taggcactca taagcgcgcc gggggaccgc atgcggaagt atacgctttg       180
     cgcgatgcgt atacgcttct ctccggcgat acgacgatag cgggttgtga tgattcacac       240
     cgcatacacg attatcttcg cacccgtcac aacggtatct ttcacactgt ttcgatggcg       300
     gtaacgctgg agccgtgttc tcacagcgga aaaaccccct catgcgcatt gttgatccga       360
     gatctgggaa tcaagagagt ctatatcagc gttaaagacc caaatcctgc cgctgctggc       420
     ggagcttcac tcttaagcga cgccggtgcc gaatgtgttt tcggcattat ggaagaagag       480
     ggggaaaaac tccttgagcc gtttatccgg tggcagaaga gcccttttgt ctttttcaaa       540
     tgggctcagc gtctcgacgg taccatcgat aacggaacga tcagctcgca aagttctagg       600
     gaacatatgc atgcactgcg tgatcggtgc gatttgatcg ttatcggcgg caatacggta       660
     cgacacgatc gccccacgtt ggatgcaagg ctggtggacg gaaaagcgcc ggatgtattg       720
     atctattcgc agatggggga atttgatcag agcatccctt tgttcagtgt accggataga       780
     aaagtatatg ttgagtcgtc attggagcgt cttaaggagt attcactggt tatgatcgaa       840
     gggggcacat ccatgttcca agcgagccag aacacgtgcg actggtatct gtgttacctt       900
     gcacctaagt tgggaggcgg attacagaac atgggaccga tacaagagga ttttgaggta       960
     ctgcacgcta aaatcaccga taacatactt ctttggatga agaaaaaata g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page