(data stored in ACNUC7421 zone)

EMBL: CP002355.PE465

CP002355.PE465       Location/Qualifiers
FT   CDS_pept        452697..452990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0466"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: ant:Arnit_1006 DNA polymerase beta
FT                   domain-containing protein region; PFAM: DNA polymerase beta
FT                   domain protein region; SPTR: DNA polymerase beta domain
FT                   protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33133"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW8"
FT                   /protein_id="ADR33133.1"
FT                   /translation="MTKNEILEILKTLKPRYEQDGLILVGLFGSFSRGEEKSDSDVDIV
FT                   YEIEKGKTFSMFKYLKYLADLEKYLNHKVDLVRAETIKSDLKPYIYKDMIYV"
     atgacaaaaa acgaaattct tgaaatactc aaaactctaa agccccgtta tgaacaagac        60
     ggcttgatcc tcgtcggctt attcggcagt ttctcgcgcg gtgaagagaa gagtgatagc       120
     gatgtcgata ttgtctatga gattgaaaaa gggaaaacct tttcaatgtt taaatatctc       180
     aaatacctcg ctgatcttga aaaatatctc aatcacaaag tagatttagt cagagccgaa       240
     accatcaaaa gtgatttaaa accttatatc tacaaggaca tgatttatgt ctag             294
//

If you have problems or comments...

PBIL Back to PBIL home page