(data stored in ACNUC7421 zone)

EMBL: CP002355.PE466

CP002355.PE466       Location/Qualifiers
FT   CDS_pept        452983..453327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0467"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: ant:Arnit_1007 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33134"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW9"
FT                   /protein_id="ADR33134.1"
FT                   /translation="MSRDWKFYLRDILAECQNIRKFTANITFEEFTENTEKVYATAKAF
FT                   ENIGEAVKQIPKEIQDEYSSVPWSEIAKMRDVLTHHYFGLDDKVLWDTLADDFIMFEEV
FT                   VEEIAKKYLD"
     atgtctaggg attggaaatt ttatctcaga gatattctcg ccgagtgtca gaatatccga        60
     aagtttacgg ccaacatcac gtttgaagaa tttacagaga atactgaaaa agtgtatgcg       120
     acggcaaaag catttgaaaa tatcggtgaa gcggtcaagc agatacccaa agagatacaa       180
     gatgagtata gcagtgtgcc gtggagcgaa attgccaaaa tgagagatgt gttaacgcac       240
     cattattttg gattggatga taaagtgctt tgggatactc tggctgatga ttttattatg       300
     tttgaagagg tcgttgaaga aatagcgaaa aagtatttgg attaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page