(data stored in ACNUC7421 zone)

EMBL: CP002355.PE467

CP002355.PE467       Location/Qualifiers
FT   CDS_pept        complement(453398..454270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0468"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR004635: IPR002142; KEGG: tdn:Suden_0685
FT                   peptidase S49, SppA; PFAM: peptidase S49; SPTR: Peptidase
FT                   S49, SppA; TIGRFAM: signal peptide peptidase SppA, 36K
FT                   type; PFAM: Peptidase family S49; TIGRFAM: signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33135"
FT                   /db_xref="GOA:E4TZX0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX0"
FT                   /protein_id="ADR33135.1"
FT                   /translation="MIEFVKKIGSCLARGLKFIQEHFKATVLVLIVLWLIIPSSENGIT
FT                   PHNLQKIALSGPILDATPIVAQIDEARENDGIKGVLFSIDSPGGAVAPSVEIAYAIKRL
FT                   SETKPTVVYAAGIMASGGYYSGIWGNEIIANPGSMIGSIGVIMEGADISGLMEKVGVKT
FT                   QVVHAGTYKQVGTFDREWSAAERAELNKVIDGTYSMFVVDVARARKLDPLRSGEYADAH
FT                   IFTALQAKKAGLVDSIGVEYDAKKRVEELSKVKDPTWNKEDPMDRFFKRFAAEGATLAH
FT                   LYFPPITLK"
     atgattgaat ttgtcaaaaa gatcggttca tgtctggcga gagggctgaa atttattcaa        60
     gaacatttca aagcgacggt actggttctc attgtactgt ggcttataat cccctcgagc       120
     gaaaacggaa tcactcccca caatctccaa aaaatagcct tgagcggtcc tattttggat       180
     gcaactccaa tcgtcgcaca gattgacgaa gcacgcgaaa atgacggtat caaaggggta       240
     ctcttcagta tcgattcccc cggcggtgcg gttgccccct cggtagaaat cgcgtacgcg       300
     atcaagcgtc tcagcgaaac aaagccgacg gtcgtttatg ctgcggggat aatggctagc       360
     ggcggctatt attccggtat ctggggaaat gagatcatcg ccaatcccgg cagtatgatc       420
     ggatccatcg gtgtcattat ggagggtgcc gatatctcgg gactgatgga aaaagtgggg       480
     gttaaaaccc aagtcgttca tgcgggaacc tacaaacagg tagggacgtt tgacagggag       540
     tggagtgcgg ctgagcgtgc ggaactcaat aaagtgatcg acggaaccta ttctatgttc       600
     gtcgtggatg tcgcacgtgc acgaaaactg gatccgctga gaagcggaga atacgccgat       660
     gcccacattt ttaccgcatt gcaagctaaa aaagcaggac tggtcgatag tatcggcgtc       720
     gaatacgatg ccaaaaaacg ggtagaagaa ctcagtaaag taaaagatcc gacttggaac       780
     aaagaagacc cgatggaccg atttttcaag cgctttgcgg cagagggagc cacactggct       840
     cacctctatt ttccgcccat tacattgaaa taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page