(data stored in ACNUC7421 zone)

EMBL: CP002355.PE469

CP002355.PE469       Location/Qualifiers
FT   CDS_pept        455678..456037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0470"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789; KEGG: tdn:Suden_1034 response regulator
FT                   receiver domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver domain protein; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33137"
FT                   /db_xref="GOA:E4TZX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX2"
FT                   /protein_id="ADR33137.1"
FT                   /translation="MKILVVDDSKLARLFLIKTLKELEPTAAILEAENGLIAVELFKAE
FT                   KPSAVFLDLTMPVMDGYEALKEIIKIDPNAQVVIVSADIQAQAQSTVLESGAKMMIPKP
FT                   INSEKMLSILQQLSI"
     ttgaaaatac ttgttgtcga tgactctaaa ctagcacgtt tatttcttat taaaacatta        60
     aaagaattag aaccgactgc tgctatttta gaagcggaaa acggtctcat tgccgttgaa       120
     ttatttaaag cggaaaagcc gagtgctgtt tttttggatt tgacgatgcc ggtaatggac       180
     ggttacgaag cgttaaaaga gattattaaa attgatccga acgcacaggt tgtaatcgta       240
     tcggcggaca ttcaggcaca ggcacaatct acagttttgg agtcgggtgc aaaaatgatg       300
     attccaaaac cgattaacag cgaaaagatg ttgtctatac tgcaacagct ttctatataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page