(data stored in ACNUC7421 zone)

EMBL: CP002355.PE470

CP002355.PE470       Location/Qualifiers
FT   CDS_pept        456048..456665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0471"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="COGs: COG1776 Chemotaxis protein CheC inhibitor of
FT                   MCP methylation; InterPro IPR007597; KEGG: tdn:Suden_1035
FT                   CheC, inhibitor of MCP methylation; PFAM: CheC domain
FT                   protein; SPTR: CheC, inhibitor of MCP methylation; PFAM:
FT                   CheC-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33138"
FT                   /db_xref="GOA:E4TZX3"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX3"
FT                   /protein_id="ADR33138.1"
FT                   /translation="MQQNGFTDDHLDMLRELMNIAMGNATASIADLLEAFGKMHIPQIL
FT                   ISDMEGLASYIQQTISDDQRNYVTKQLFGGMFSGEFLFVISEESALHLGHHLYDVDNPS
FT                   DGDILDAVIELTNILSATIISRLTEELNTKVQFFVPSTELIDGNALISQEDIMNYHRII
FT                   IISTQMEFEHQNINGHIFILTKDGMIESLKALIDRKLEELYA"
     atgcagcaaa acgggtttac agacgatcat ctcgatatgc tccgggagct gatgaatatc        60
     gctatgggga atgcgacggc gagtatcgcc gatttattgg aagcgttcgg caaaatgcat       120
     attcctcaga ttctgatcag cgatatggaa gggttggcca gttatattca acaaacaata       180
     tccgacgatc agcgcaatta tgtgacgaaa cagttgttcg gagggatgtt cagcggagag       240
     tttttatttg tgatttcgga agagtccgca ttgcatcttg gacaccatct ttatgacgtc       300
     gacaacccgt ctgatgggga catactggat gcggtaattg aactgaccaa tatcctcagt       360
     gcgacgataa tcagccgttt gacggaagag ctgaatacga aagtacagtt ttttgtccct       420
     tcgacggaac tgattgacgg caatgctctg atcagtcaag aagatattat gaattatcac       480
     cgaatcataa ttatcagtac gcagatggaa tttgaacatc aaaatattaa cggacatatt       540
     ttcatcctta cgaaagacgg gatgatcgaa agtttaaaag ccctaattga tcgcaaactc       600
     gaagagctgt acgcctaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page