(data stored in ACNUC7421 zone)

EMBL: CP002355.PE471

CP002355.PE471       Location/Qualifiers
FT   CDS_pept        456665..457951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0472"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterProIPR000014:
FT                   IPR000160: IPR013767: IPR019825: IPR 000700; KEGG:
FT                   tdn:Suden_1036 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold domain protein; SMART: GGDEF
FT                   domain containing protein; PAS domain containing protein;
FT                   SPTR: GGDEF domain/pas/pac sensor domain protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33139"
FT                   /db_xref="GOA:E4TZX4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX4"
FT                   /protein_id="ADR33139.1"
FT                   /translation="MVTIPYPNVLLDALEIGVMIIDENFEVRYWNQWLEINTSHSASEM
FT                   IGKNLRDFYPQIDYKVLARKIRTTLRLESPTFYDASVQNRFIEIPRTKITTSLLMNMQL
FT                   QVTISPYIVEDGMVMVSIYDISDLHELKLTLQSQMKKISELNSELHRDKMIIDANLLIV
FT                   KMDEECKIIEATTAFLDFFGYQPESVVGNYLPRIFGEVSVDFDTIQICDAIARHQKSSG
FT                   EVKAVLASGEEVWFDTVVTPLNDDESDTLSYTVIFHDISDKKRIELLSITDPLTKLFNR
FT                   HKFNEVFENMVLRRHWDEHRTFGLIIADVDHFKRVNDTFGHQSGDRVLIEVAHIFSQTI
FT                   RTGDILARWGGEEFVCLLPDVDREKALYVAEKLRLAVEQLHFPDVGTVTSSFGVTIFAS
FT                   GDTQESMMHRADLSLYKAKENGRNRVEYL"
     atggttacga tcccttatcc taacgttctc cttgatgccc ttgaaatagg cgttatgatc        60
     attgatgaga attttgaagt ccgttactgg aatcaatggc tggagatcaa tacatcgcat       120
     tcggcatcgg aaatgatcgg taaaaacctg cgcgattttt atccgcagat cgactacaag       180
     gtacttgcga gaaaaatacg gacaacgtta cgattagagt ccccgacttt ttacgacgca       240
     tcggtacaaa accgttttat cgaaataccc cggacgaaaa ttacgacctc tctgctaatg       300
     aatatgcagc tacaggtgac gatctctccg tatatcgtag aagacgggat ggtgatggta       360
     tcaatttacg atatcagcga tttgcatgag ttgaagctaa ccctccaatc ccaaatgaaa       420
     aaaatctctg aactcaacag cgaactgcat agagataaaa tgattatcga tgccaatctt       480
     ttgattgtca aaatggatga agagtgtaaa atcattgaag cgacgacagc atttttggat       540
     tttttcggtt atcagccgga aagtgtagtc ggaaactacc ttcctcgaat attcggggaa       600
     gtttcggttg attttgatac gattcagatt tgcgatgcga tcgcgcgcca tcagaaatct       660
     tcaggcgaag tcaaagcagt cctggcttcg ggtgaagaag tgtggttcga caccgttgta       720
     acccctttga atgatgatga gagcgataca ttgtcttata ccgtcatttt tcacgatatc       780
     agcgataaaa aaaggataga actcctctct ataaccgatc cgttgacaaa actgtttaat       840
     cgccataagt ttaatgaagt gtttgaaaat atggttcttc ggcgccactg ggatgagcat       900
     cggaccttcg gtcttattat tgccgatgtc gaccatttta aacgggtgaa cgatacattc       960
     ggacatcaaa gcggagatag ggttttgatt gaagttgcgc atatcttttc tcagacgata      1020
     cggacgggag atatattggc acgctggggc ggggaagaat tcgtatgtct tttgccggat      1080
     gtcgatcggg aaaaagcgct ttatgtcgct gaaaaactcc ggttggcggt agaacagctc      1140
     cattttcctg atgtgggaac ggtcacctct tccttcggcg tgacgatttt tgcttcggga      1200
     gatacgcagg agagcatgat gcacagagcg gatttatcgc tgtacaaagc gaaagaaaac      1260
     ggacgaaacc gagttgaata tctttaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page