(data stored in ACNUC7421 zone)

EMBL: CP002355.PE474

CP002355.PE474       Location/Qualifiers
FT   CDS_pept        459014..460282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0475"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="COGs: COG1419 Flagellar GTP-binding protein;
FT                   InterPro IPR020006: IPR000897: IPR003593; KEGG:
FT                   tdn:Suden_0703 flagellar biosynthesis regulator FlhF; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   SMART: AAA ATPase; SPTR: GTP-binding signal recognition
FT                   particle SRP54, G-domain; TIGRFAM: flagellar biosynthetic
FT                   protein FlhF; PFAM: SRP54-type protein, GTPase domain;
FT                   TIGRFAM: flagellar biosynthetic protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33142"
FT                   /db_xref="GOA:E4TZX7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX7"
FT                   /protein_id="ADR33142.1"
FT                   /translation="MKILTFSGATPAEALKKAQLEVGEEAMLIETREVQKKSLGKSALY
FT                   EIVVGVEENAAPAPKSKAPSDEPFMKQRPLAQKSSDVLYNISAAAKQISKIAEVTEEER
FT                   PSRQTPVRESEDLKRIKEEIEKLGDKVKLIQNMFWSEKSPKTTAAIPPEFAEIYRLAQQ
FT                   SGMDQEHLDEIMHLTLEHMPSKMRESSETVKRYFQVLMRKMIPVRLESAPRPGSKKVIM
FT                   LVGPTGVGKTTSIAKLAARFSYLLEKKYKVGLVVLDTYRIGAVEQLMQYARMMKLGIET
FT                   VVDPPEFSSALNALRYSDYILIDTMGSSPYDKGKIEKIYECLRDNNTDYTVDVVLVMPS
FT                   SIKYDDLKATYENFAPLGIDTMMFTKLDETRGFGNIFSLVYETKVPISYFSVGQEVPED
FT                   LVVATSDFLVDCLMNGFNRGESA"
     atgaaaattt tgacatttag cggtgccact cctgccgaag cgctcaaaaa agcgcagttg        60
     gaggtaggcg aagaagcgat gttgatcgaa acacgtgaag tacaaaagaa atcactcggg       120
     aaaagtgctt tgtacgagat cgttgtcggc gttgaagaga atgccgctcc tgctccaaaa       180
     tcaaaggctc cgagtgatga gccgtttatg aagcagcgtc cgttggcaca aaaaagcagc       240
     gatgtccttt ataatatttc cgccgccgca aaacagatat ccaaaattgc tgaagtgacg       300
     gaagaagagc gcccctcccg ccaaactccc gttagagaga gtgaagatct aaaacggatt       360
     aaagaggaga tagaaaagct cggcgataaa gtcaaactga tccaaaatat gttttggtcg       420
     gaaaaatcac ccaaaacaac cgcggctatc ccccctgaat ttgccgagat ttaccgcctt       480
     gcccagcaaa gcggaatgga ccaggaacat ctcgatgaga tcatgcacct cacactggag       540
     catatgccct ctaaaatgag agagagctct gaaaccgtca agcgctattt tcaagtgttg       600
     atgcgtaaaa tgatccccgt gcgtctagag agtgctccac ggccggggag caaaaaagtg       660
     atcatgcttg taggccctac gggagtcgga aaaacaacgt cgattgccaa actggctgca       720
     cgtttttcgt atcttttgga gaaaaaatac aaagtaggcc ttgtggttct ggatacctat       780
     cgtatcggag cggtagaaca gctgatgcaa tatgcccgta tgatgaaact cgggattgag       840
     acggtcgtgg acccgccgga attttcgagt gctttgaacg cattgcgtta cagtgattat       900
     attttaatcg atacaatggg atcgtctccg tacgataaag ggaaaataga aaaaatctac       960
     gaatgtctgc gagacaacaa tacagattat acggtggatg tcgtattagt gatgccaagc      1020
     tcgatcaagt acgatgatct taaagctact tacgaaaatt ttgctccgct cgggatagac      1080
     acgatgatgt ttacaaaact ggacgaaacc agaggtttcg gaaatatttt ctccctcgtg      1140
     tacgaaacga aagttccgat cagctatttt tcggtcggac aggaagttcc tgaggatttg      1200
     gttgtagcga catctgactt tttggtggat tgtttgatga acggatttaa cagaggtgag      1260
     agtgcatga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page