(data stored in ACNUC7421 zone)

EMBL: CP002355.PE476

CP002355.PE476       Location/Qualifiers
FT   CDS_pept        461223..461546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33144"
FT                   /db_xref="GOA:E4TZX9"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX9"
FT                   /protein_id="ADR33144.1"
FT                   /translation="MRGSNFVYFLTIQGFFVGIVFGILQSDSAENFLGWVILISLFFYL
FT                   FAHLCVGFFFQSLGVKAHSFPKKAHEHNLDFFVREINKREQFIDAFYTHKSELLDDQGR
FT                   GKG"
     atgaggggtt cgaattttgt ctattttcta acaatacagg ggttttttgt cggtattgtt        60
     tttggaatac tgcaatcgga ttctgctgag aattttttgg gatgggtcat tttgattagt       120
     ctcttttttt accttttcgc ccatttgtgt gtcgggttct ttttccagtc attgggagtc       180
     aaggcgcata gctttccgaa aaaagcgcat gagcataatc tcgatttctt tgtacgtgaa       240
     atcaataagc gcgagcagtt tatcgacgct ttttatacgc ataaatcaga gttgctggat       300
     gatcagggac gggggaaagg atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page