(data stored in ACNUC7421 zone)

EMBL: CP002355.PE477

CP002355.PE477       Location/Qualifiers
FT   CDS_pept        461543..462235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0478"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit; InterProIPR014284: IPR012845:
FT                   IPR007627: IPR007630: IPR 000943; KEGG: tdn:Suden_0706
FT                   flagellar biosynthesis sigma factor; PFAM: sigma-70 region
FT                   4 domain protein; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, FliA/WhiG family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG family;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33145"
FT                   /db_xref="GOA:E4TZY0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY0"
FT                   /protein_id="ADR33145.1"
FT                   /translation="MSGTNAYTQELKHREDQLAIQFLPAVKAMSFRLKERLPSSVDYMD
FT                   LCAIGTEELVKLARRYDESQNDSFWGYAKTRVYGAMLDYLRSLDMVSRSSRRLIKEIDH
FT                   AIEVYMADHDDEPSDSELSVILGIEEDKVREARIASDIYTVLPLDDQLGTPEEGGMLER
FT                   MEHEDLIEAIQEVLMTFEEREQIIIQLYYFEELTLKEISEIVNITESRISQIHKSVIRR
FT                   IKEAVGGQ"
     atgagcggta ccaatgccta tacgcaagag ctgaaacacc gtgaagacca attggctatc        60
     cagtttcttc cggccgttaa agcgatgtcg tttcgcttga aagaacggct tcccagttcg       120
     gtcgattata tggatttgtg cgccatcgga acggaagagt tggtgaaact ggcacgccgc       180
     tatgatgaga gccaaaacga ttcgttttgg ggctatgcca aaacacgtgt ttacggagca       240
     atgctcgatt acctaagatc actcgatatg gtcagccgtt ccagccgccg attaatcaaa       300
     gagatcgatc acgcgattga ggtctatatg gccgatcatg atgacgaacc cagtgacagt       360
     gagctttccg ttattttggg aatcgaagaa gataaagtgc gcgaagcgcg tatcgcatcg       420
     gatatctata cggtcttgcc gttggatgat cagctcggga cccctgaaga ggggggaatg       480
     ttggagcgga tggaacatga agatctgatc gaagcgattc aagaggtact gatgaccttt       540
     gaggagcgcg aacagattat tatccagctc tattattttg aagaactcac cctcaaagag       600
     atcagtgaga tcgtcaatat taccgaatcg aggatttcac aaattcacaa atcggtcatt       660
     cgtcgaatta aagaagcggt aggagggcag taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page