(data stored in ACNUC7421 zone)

EMBL: CP002355.PE479

CP002355.PE479       Location/Qualifiers
FT   CDS_pept        463322..464188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0480"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="COGs: COG1886 Flagellar motor switch/type III
FT                   secretory pathway protein; InterPro IPR012826: IPR001543:
FT                   IPR001172; KEGG: tdn:Suden_0708 flagellar motor switch
FT                   protein FliY; PFAM: surface presentation of antigens (SPOA)
FT                   protein; SPTR: Flagellar motor switch FliN; TIGRFAM:
FT                   flagellar motor switch protein FliN; PFAM: Surface
FT                   presentation of antigens (SPOA); TIGRFAM: flagellar motor
FT                   switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33147"
FT                   /db_xref="GOA:E4TZY2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY2"
FT                   /protein_id="ADR33147.1"
FT                   /translation="MSDFPGVFATEAVATIEGLTGQTPTITLKEAEEISIISNVIPPIA
FT                   QIHVSFSGAAAGRGIVMMPPQLATALGDMMLGGDGEAQDTMSDEDMDAAKEIVSNIVGA
FT                   MSTTLASQKELPKFTIKPERAEFIPESGEVNLDGYAKMFVFTFALGHINSLMMLAIDST
FT                   INEALTGEKAAPAPASNSSNIFDAPSSSVPAVKLDEGEMKNIGLIMGVKLPVRVRIGKK
FT                   KMLLKDVLSMDIGSVIELNQLANDPLDILVDDHVIAQGEVVIVDGNFGVQITSIGTKRD
FT                   RLNKLKG"
     atgagtgatt ttcccggagt atttgcaact gaagctgttg ccacgataga gggattgacg        60
     ggtcagactc ctacgattac acttaaggag gcggaagaaa tttcgatcat ctccaatgtc       120
     atccccccta ttgcacaaat tcatgtgagt ttcagcgggg cggcggcagg acgcggtatc       180
     gtgatgatgc ctcctcagct cgcgacagcg ctcggagaca tgatgctcgg cggtgatggg       240
     gaagctcagg atacgatgtc ggatgaggat atggatgcgg caaaagagat cgtttccaat       300
     atcgtcgggg cgatgagcac cacattggca tcccaaaaag agcttccgaa gtttacgatt       360
     aagcccgaac gtgcggaatt tattcccgaa agcggagaag tcaatcttga cgggtatgcg       420
     aaaatgttcg ttttcacctt tgcgctgggg catatcaatt cattaatgat gctggcgata       480
     gactcaacga tcaatgaagc attgacggga gaaaaagcgg ctcctgcacc tgcgagcaac       540
     agcagtaata tttttgatgc tccttcttct tccgtaccgg ccgttaaact ggatgaagga       600
     gagatgaaaa atatcggttt gattatgggg gtaaagcttc cggtgcgggt tcggatcgga       660
     aagaaaaaaa tgcttctcaa agatgtcctc agcatggata tcggttcggt aatcgagctg       720
     aatcagcttg ccaatgatcc gcttgacatt ttagtggatg atcatgtcat tgcacagggt       780
     gaagttgtta tcgtggatgg aaatttcggt gttcaaatca cctctatcgg aaccaagcga       840
     gatcgattga ataaattaaa aggataa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page