(data stored in ACNUC7421 zone)

EMBL: CP002355.PE48

CP002355.PE48        Location/Qualifiers
FT   CDS_pept        46854..47717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0048"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2107 periplasmic solute-binding protein;
FT                   KEGG: tdn:Suden_2004 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Putative periplasminc
FT                   binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32716"
FT                   /db_xref="GOA:E4TWA0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA0"
FT                   /protein_id="ADR32716.1"
FT                   /translation="MKKMVIAHSPDADDIFMYYAIKFGWVGKENTVFENIALDIETLNT
FT                   EALKGTYDITAISFGLYPHIRSDYALLRTAVSFGQGYGPKLIRKKETVLKKRFKVALSG
FT                   KYTTNALLFRIVYPDAKIIYMNFLEIEQAVLDGVVDAGVLIHESILGYDESLEVERELW
FT                   DVWCELSGGDLPLPLGGMAIRRSLPLTSAIEYESVLTKAVQIARDHKETLSKMLMERNL
FT                   VRIDAPTLEKYLELYANDESITLNETQYKAIELLFDLGYKHGFFDAKIDPRDFMLPLEY
FT                   NELRYS"
     gtgaaaaaaa tggtgatagc ccactccccc gatgccgacg atatttttat gtattacgcc        60
     attaaattcg ggtgggtcgg aaaagagaat actgtttttg aaaatattgc cttagatatt       120
     gaaacgctca atacagaagc ccttaaagga acgtatgaca ttacggctat cagtttcggg       180
     ctctatcccc atatccgcag cgattatgcc cttttgcgta cggcggtaag tttcggtcag       240
     gggtacggcc caaaacttat ccgaaaaaaa gagaccgttc ttaaaaagcg gttcaaagtt       300
     gctctcagcg gaaaatatac gacgaatgca ttactgtttc ggattgtcta tcccgatgcg       360
     aaaataatct atatgaattt tttggagata gagcaggcgg ttttggacgg agtcgtcgat       420
     gccggagtcc ttatccatga atctatttta ggatacgatg agtcgcttga agtcgaacgg       480
     gaactgtggg atgtatggtg tgaactctca ggcggtgatc tgcctctgcc gctcggcggt       540
     atggcgatcc gccgctcatt gccgctgacc tccgctatcg aatatgaatc tgttttgacc       600
     aaagcggtac aaatcgctcg tgatcacaaa gagaccctct ccaaaatgct gatggaacgc       660
     aatcttgtcc gtatcgatgc gccgacactg gaaaaatatc tcgaacttta cgccaatgac       720
     gaatctatta cacttaatga aacccaatac aaagcgatcg aacttttatt tgatctagga       780
     tacaaacacg ggttctttga cgccaaaatc gatccgaggg actttatgct cccgctcgaa       840
     tacaacgaat tgaggtactc ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page