(data stored in ACNUC7421 zone)

EMBL: CP002355.PE480

CP002355.PE480       Location/Qualifiers
FT   CDS_pept        464191..464979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0481"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="COGs: COG1611 Rossmann fold nucleotide-binding
FT                   protein; InterPro IPR005269; KEGG: tdn:Suden_0709
FT                   hypothetical protein; PFAM: Conserved hypothetical protein
FT                   CHP00730; SPTR: Lysine decarboxylase family protein; PFAM:
FT                   Possible lysine decarboxylase; TIGRFAM: conserved
FT                   hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33148"
FT                   /db_xref="GOA:E4TZY3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY3"
FT                   /protein_id="ADR33148.1"
FT                   /translation="MARRHGKTKEYESSRYVKDIKSADVWSVFKIIADFVQGFDELGDL
FT                   GPSVTIFGSARLDENHPYYTQAMTLANMLGEKGYNVITGGGPGIMEAANRGAYEVETVE
FT                   SIGLNIELATEQQPNPYITKGQSFDYFFSRKVMLVKYSMAYVIFPGGFGTLDEMFEALT
FT                   LIQTRKVWGVRLFVVGTEFYAPLLQFIEDKMLAEGMIDDKDVQLINLTDDLDFVVREIE
FT                   KSLISQIHTMEKEGLTDTKYYKALTSHVDETHSYAGQGSS"
     atggcgcgtc gacatggcaa aacaaaagag tacgaaagca gccgctatgt caaagatatc        60
     aaatcagcgg atgtttggag tgtttttaaa ataattgccg attttgtcca gggatttgat       120
     gaattaggag atttaggacc ttcagtaacc attttcggaa gtgcccgttt ggatgaaaat       180
     catccgtact acacccaagc gatgacattg gcaaatatgc ttggagagaa ggggtataac       240
     gttattaccg gcggaggacc ggggattatg gaagcggcaa atcgcggagc gtatgaggtc       300
     gaaaccgtag agtcgatagg gcttaatatc gaactggcta ccgaacagca acccaaccct       360
     tatattacca aagggcagag ttttgactac tttttttccc gaaaagtaat gctcgttaaa       420
     tactcgatgg cgtatgttat ttttcccgga gggttcggga cactcgatga aatgtttgaa       480
     gcgttgactt tgattcaaac ccgtaaagta tggggcgtcc gtttattcgt cgtagggacg       540
     gagttttatg ctccgttatt acaatttatc gaagataaaa tgttggctga ggggatgatc       600
     gacgataaag acgttcaact tatcaatttg acagatgatt tggactttgt tgtccgagag       660
     attgaaaaat cgcttatatc tcaaatacat acaatggaga aagaggggct gaccgatacg       720
     aagtattata aagcgttgac ttcccatgtg gatgaaacac actcttatgc aggacaagga       780
     agcagttag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page