(data stored in ACNUC7421 zone)

EMBL: CP002355.PE482

CP002355.PE482       Location/Qualifiers
FT   CDS_pept        466148..467377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: pmx:PERMA_1526 general
FT                   substrate transporter; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator family transporter; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33150"
FT                   /db_xref="GOA:E4TZY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY5"
FT                   /protein_id="ADR33150.1"
FT                   /translation="MTSKKKIVAAGIIGNVIEYYDFALIGFLAVMMGNLFFPSHDPFLS
FT                   LLGSFGAFAAGMIMRPVGALIFGHIGDRVSRRTALMSSLLMMALPTFLIGFLPTYAQIG
FT                   ILAPILLVLLRMIQGLSVGGEYASSIVYLVEQSAPDHQNLYGSFVSVGAKIGMALGSGF
FT                   CGALLWYIGGDAMGEWGWRIPFWASIIIAAAGLYLRRNLTDDYRPSEDKTVPIVAILRH
FT                   HRREFWQFLTIASAIWVFYYTVFIYLPIWLEGSAGLSKAEAGQINTLSIVVGVVFIPLM
FT                   AMVADVIGSLRLMRLTSITLAISVYPLFYWMSIGGFWGALAGTIGLVILLCAFQAPIFA
FT                   STVNALHYHGYRASFTAVILGSAAGIVGGITPALMTSITEYSGNPFAPSYLIAAASLMG
FT                   GWGILRNVRA"
     atgacatcca aaaagaaaat tgttgcagcc gggatcatcg gcaacgtcat agaatactac        60
     gatttcgccc ttatcggttt tttggccgtg atgatgggga acctcttttt cccctcgcat       120
     gaccctttcc tctccttatt aggttctttc ggtgcctttg ccgcagggat gattatgcgt       180
     ccggtcggcg cattgatttt cggacacatc ggtgatcgtg tcagtcggcg tacggcattg       240
     atgagctcgc ttttgatgat ggcgctccct acctttctta tcggtttttt gccgacgtat       300
     gcgcaaatcg ggattttggc tccgatcctt ttggtattgc ttcgtatgat ccagggactc       360
     tccgtcggag gagaatacgc cagctccatc gtctatttgg ttgagcagtc cgcaccggat       420
     catcagaatc tctacggctc gtttgtctcc gtcggagcta aaatcggaat ggcgttggga       480
     tcgggatttt gcggggcctt gttgtggtat atcggtggcg atgcgatggg tgaatggggt       540
     tggagaatac cgttttgggc gagtattatt attgcggcag cggggcttta cctgcgacgt       600
     aatctaaccg atgattatag accgagtgaa gacaaaaccg ttccgatcgt tgccatttta       660
     cgccatcatc gccgtgagtt ttggcagttt ttgaccattg catcggcaat atgggtattt       720
     tactataccg tctttattta tcttcccatc tggctagagg ggagcgcggg actcagcaaa       780
     gccgaagcgg ggcagattaa tactctctct attgttgtcg gtgtagtatt tatcccgttg       840
     atggctatgg ttgcggatgt cataggttcg cttcgtctga tgcgcttaac ctctataacc       900
     ctcgcgataa gcgtttatcc tctcttttat tggatgagca tcggaggttt ttggggtgca       960
     ttggcgggga cgatcggact ggtaattttg ctttgtgcgt ttcaggctcc catctttgct      1020
     tcgacggtga atgccctgca ttatcacggc tatcgcgcat cgtttacagc ggtaatatta      1080
     gggagtgccg cagggatagt aggcggaatt acacctgctc ttatgacatc catcacagag      1140
     tatagcggca accctttcgc cccctcttat cttattgcgg ccgcttcgct gatggggggg      1200
     tggggtattc ttagaaatgt acgggcttga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page