(data stored in ACNUC7421 zone)

EMBL: CP002355.PE483

CP002355.PE483       Location/Qualifiers
FT   CDS_pept        complement(467358..468119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0484"
FT                   /product="carbonic anhydrase"
FT                   /note="COGs: COG0288 Carbonic anhydrase; InterPro
FT                   IPR001765; KEGG: cvi:CV_1136 hypothetical protein; PFAM:
FT                   carbonic anhydrase; SPTR: Carbonic anhydrase; PFAM:
FT                   Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33151"
FT                   /db_xref="GOA:E4TZY6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY6"
FT                   /protein_id="ADR33151.1"
FT                   /translation="MDKRTFLKFFALTSSSLLLANSAEASSAHAAPNTQELQEIAQKMF
FT                   AEVISQNDYYVNHQGSAFFEKLKNGQHPRATVIGCSDSRFQSAALDATAENDLFIIRNI
FT                   GNQFSSNMGSVEYGVRHLNTPLLIIVGHSRCGAIKAALGDYSSEGPHIIKELDSLSLAV
FT                   RKTSMMGTEEAKWLAAVVSNINQQVYYAQKEFKGDVESGKLTIVGVVYDLANDFNNGYG
FT                   RLKIVNINGESNPGKMMDYPLMKSLFKPVHF"
     atggataagc ggacctttct caaatttttt gccctcacct caagttcgct gcttttggcc        60
     aattcagcag aagcttcttc agcccatgcc gcccccaata cccaagagct gcaggaaata       120
     gcacaaaaga tgttcgccga agtcatctcc caaaacgact attacgtcaa tcatcagggc       180
     tccgctttct ttgaaaaact gaaaaacgga caacatccgc gtgccacggt catcggatgc       240
     tcggattccc gttttcaaag tgctgccctc gacgcaacgg ctgaaaatga tctttttatt       300
     atccgtaata tcggcaatca gttcagctcc aacatgggga gcgtcgaata cggtgtacgc       360
     catctcaata ccccgctgct catcatcgtc ggacattcgc gctgcggagc gattaaggcg       420
     gctctgggcg attactcttc cgaggggccg cacatcatca aagagctcga ttctctctca       480
     ctagccgtac gaaaaacatc aatgatgggg acggaggaag ccaaatggct tgccgccgtt       540
     gtcagcaata tcaatcaaca ggtgtattac gcacaaaaag agtttaaagg ggatgtggag       600
     agcggaaaac tcaccatcgt cggtgttgtc tatgatttgg ccaatgattt caataacggc       660
     tacggacgcc tcaaaatcgt caacatcaat ggagaaagca atccggggaa aatgatggac       720
     tatcccttaa tgaaatcgct cttcaagccc gtacatttct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page