(data stored in ACNUC7421 zone)

EMBL: CP002355.PE484

CP002355.PE484       Location/Qualifiers
FT   CDS_pept        complement(468164..469027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0485"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR011812:
FT                   IPR001264; KEGG: cte:CT2025 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: glycosyl transferase
FT                   family 51; SPTR: Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; TIGRFAM: monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: Transglycosylase;
FT                   TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33152"
FT                   /db_xref="GOA:E4TZY7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY7"
FT                   /protein_id="ADR33152.1"
FT                   /translation="MQKLKTILLLLLLAGAIDIGRYFIYPNIDDLKDIRPIPTAFMEYR
FT                   QNEWADENRDMEITQKWVSMSQISPNVIKAVLIGEDDKFWNHDGFDVTGMEQALERSLK
FT                   KGSVAGGSTISQQLSKNLYLSPSKNPVRKIKEAIITWRIEHALSKRRILEIYLNVAEWG
FT                   DGIFGIEAAARHYYHKSAKNLTGQEAARLAAVLPNPIKYDPTGSQKYVKNRSRIIYKIM
FT                   KRRGIVIPQFKEVMTPPRESESPAVENNQSITDLFDQTAPEETAPQEQIDVPVSNGTEK
FT                   NESITF"
     atgcaaaaac tcaaaactat ccttctcctt ttactcctgg cgggggctat cgacatcgga        60
     cgctatttca tctatcccaa cattgatgat ctcaaagata tccgtcctat accgaccgca       120
     tttatggaat accgccaaaa cgagtgggcc gatgaaaacc gggacatgga aatcacccaa       180
     aaatgggtct ccatgtcaca aatttccccg aacgtgatca aagcggtgtt aatcggagaa       240
     gacgacaagt tttggaatca cgacggattt gacgtaacag ggatggagca ggcgctggag       300
     cggagtctca aaaaaggctc cgtcgccgga ggaagcacca tcagccagca gctctctaaa       360
     aatctctacc tctctccgag caaaaatccg gtacgcaaaa tcaaagaggc gatcatcacc       420
     tggcggatcg aacatgccct ctccaaacgg cgtattttgg aaatctatct caacgtcgct       480
     gaatggggtg acggtatatt cggaatcgaa gcggcggcac gccattatta ccataaaagc       540
     gccaaaaacc tgacgggaca agaagcggcg cgtctggcgg cggtcctgcc caatccgatc       600
     aaatacgatc cgacagggag ccaaaagtac gtcaaaaacc gttcacgtat catctacaag       660
     attatgaaac gcagagggat cgtcattcct caattcaaag aggtcatgac accgccgagg       720
     gaaagcgaat cccctgctgt agaaaataat caaagtatca ccgatctttt cgatcaaact       780
     gccccggaag aaacggcacc ccaagagcaa atcgatgtac cggtttcaaa cggtaccgaa       840
     aaaaatgagt ctataacgtt ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page