(data stored in ACNUC7421 zone)

EMBL: CP002355.PE485

CP002355.PE485       Location/Qualifiers
FT   CDS_pept        complement(469029..469655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0486"
FT                   /product="Uncharacterized protein family UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: tdn:Suden_1580 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0126; SPTR: Membrane
FT                   protein; manually curated; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33153"
FT                   /db_xref="GOA:E4TZY8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY8"
FT                   /protein_id="ADR33153.1"
FT                   /translation="MSEFNLVVFADILGIIAFALSGFLVGVRSNLDLLGIIISASLTAL
FT                   GGGVVRDVILDRTPFAFNEYYPAITVLTTIAIAFAFRLYHREQIERQWLFVISDTIGLV
FT                   AFSITGALLAIDAGFNFFGVIILSFLTAIGGGVLRDILINQVPAVLVSDFYGSIALIVS
FT                   ILLLVFSAVIGLSTLSVAIVAFIAITLRLAAYIKGWHLPTLNTDH"
     atgtctgaat ttaatctcgt tgtttttgcc gacattctcg gtattatcgc ctttgcactc        60
     agcggttttc ttgtaggggt tcgcagcaac ctcgatctcc tcggcataat tatctccgct       120
     tcgcttaccg cactgggcgg aggagtagtc cgtgacgtca tcttggaccg aaccccgttt       180
     gcgtttaacg aatactatcc tgccattacc gtcttaacca ctatcgccat cgctttcgcc       240
     tttcgtcttt accaccggga acagattgaa cgacaatggc tttttgtcat cagcgacacg       300
     atcggtcttg tcgcattcag tatcaccgga gcgcttttgg cgattgacgc agggttcaat       360
     tttttcggtg ttattatcct aagcttcctc accgcaattg gaggaggggt tctgcgtgat       420
     atcctcatca atcaggtccc tgccgtactc gtaagcgatt tttacggttc catcgcactg       480
     atcgtctcga ttttgctcct tgtattttcg gcagtgatcg ggttgtcgac actgagcgtt       540
     gcgattgtag cctttatcgc catcacactg cggctcgccg cctatatcaa ggggtggcat       600
     ctccctaccc taaatacgga tcattaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page