(data stored in ACNUC7421 zone)

EMBL: CP002355.PE487

CP002355.PE487       Location/Qualifiers
FT   CDS_pept        complement(470197..472296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0488"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COGs: COG0855 Polyphosphate kinase; InterPro
FT                   IPR003414; KEGG: tdn:Suden_1578 polyphosphate kinase; PFAM:
FT                   Polyphosphate kinase; PRIAM: Polyphosphate kinase; SPTR:
FT                   Polyphosphate kinase; TIGRFAM: Polyphosphate kinase; PFAM:
FT                   Polyphosphate kinase; TIGRFAM: polyphosphate kinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33155"
FT                   /db_xref="GOA:E4TZZ0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ0"
FT                   /protein_id="ADR33155.1"
FT                   /translation="MPNNYKDPALYINRELSWLQFNTRVLRQAQDESLPLFERLKFLAI
FT                   YGTNLDEFYMIRVAGLKKLFSAGVNVSGADRFTPLHQLRGIREYLHKEQEEVEYCLQGI
FT                   MKELEKEGIFFKPYKEATPEQRKYLDKYFHENIYPVVIPIAIDATHPFPHLNNLGFGQI
FT                   VKLRDKDDATIERYGLIRIPRVLPRFVEIDNRIYIPIGSIVAEHIQDLFPGYELIKFAA
FT                   FRVTRNADIAIEEEEADDFMEILEEGLKLRKKGELVRLELSVHADDDLLNFFNRHANVY
FT                   KDDIYRFQTYLNLGSLWQVVGNKDFAHLTTPSFKPRNLPPLDTDESLYATLDKQDLLLY
FT                   HPFESFEPVVRLIQIAAKDPEVVSIRMTLYRSGSKSPIVQSLINAAESGKQVTVMVELR
FT                   ARFDEENNLHWAKALENSGAHVIYGIAGFKVHAKAALITRRVDGKLKQYAHIGTGNYNP
FT                   STATIYTDISYMTSNDTITHDMTRFFHFLTGFSKKGKLHELYMAPTQIKPKVLSLIQNE
FT                   TRMGSEGVIIAKMNALVDEDIIKALYKASQAGVKIELIIRGICCLRPGVPGVSENIRVI
FT                   SLIGKYLEHARIYYFKHSTPQTYISSADWMPRNLLRRIELLTPIQGEEISNKLIQILQL
FT                   QTSDNILAYELQNDGSYVKVKHEPGNLIDSHKIAETHTNKVYNSVKKQTPNYVQQLTAR
FT                   LFKES"
     atgccaaata attacaaaga cccagcactt tatatcaatc gcgagctgtc atggctccaa        60
     tttaataccc gtgttttgcg acaggcacag gatgaatcgc tccctttatt tgagcggctt       120
     aaatttttag cgatttacgg aaccaatttg gatgaattct acatgatccg tgtcgcagga       180
     ttgaaaaaac tcttcagcgc cggtgtcaac gtctccggag cggaccgatt tacgccgctt       240
     catcaactac gcggcatccg cgaatatctc cataaagagc aagaagaggt cgaatactgt       300
     ctgcagggga ttatgaaaga gctggaaaaa gaggggattt ttttcaagcc gtacaaagag       360
     gccactcccg agcagcgcaa atacctcgac aaatattttc atgaaaacat ctatccggtc       420
     gttattccga tcgccatcga tgcgacccat ccgtttcccc acctcaataa tctcgggttc       480
     gggcaaatcg tcaaactccg cgataaagac gatgcgacga ttgagcgtta cggcctcatc       540
     cgtattccgc gcgtccttcc ccgcttcgtc gaaatcgaca atcgtatcta tattccgatc       600
     ggaagtatcg tcgccgaaca tatccaagac cttttcccgg gctatgagct gatcaaattc       660
     gccgctttcc gcgtcacccg caatgccgat atcgcgatcg aagaagagga agcggacgat       720
     ttcatggaga ttcttgaaga gggtctaaaa cttcgtaaaa aaggggaatt ggtacgcctt       780
     gaactcagtg tccacgcgga tgatgatctt ttgaacttct ttaaccgcca tgccaatgtt       840
     tacaaagatg acatctaccg tttccaaacc tatctcaacc tcggaagcct atggcaggtg       900
     gtcggaaaca aagattttgc ccatttgacc actccgagtt tcaaaccgcg caatcttccg       960
     ccgcttgaca ccgatgagag cctctatgcg acgttggata aacaagattt gctcctttat      1020
     catccgtttg aaagctttga accggtcgta cgtttgattc agattgcggc caaagatccc      1080
     gaggtcgtct ccatccgtat gacactctat cgctccggtt ccaaatcgcc gatcgtgcaa      1140
     tcgctgatca acgctgccga atcgggcaaa caggtcaccg ttatggttga actgcgggca      1200
     cgctttgacg aagagaacaa tcttcattgg gcaaaagcac tcgaaaactc cggggcacac      1260
     gttatctacg gtattgccgg gttcaaagta catgccaaag cggcactcat tacccgtcgc      1320
     gtcgacggca agcttaaaca gtacgcccac atcggtacgg ggaactacaa cccctctacc      1380
     gcaacgatct ataccgatat cagctacatg accagcaacg atacgatcac ccacgatatg      1440
     acccgttttt tccatttcct cacgggattt agtaaaaaag ggaaacttca cgaactctat      1500
     atggctccga cgcagatcaa accgaaagtc ctctccttga ttcaaaacga aacccgtatg      1560
     ggaagcgagg gggtgattat cgccaaaatg aacgccctag tcgatgaaga tattatcaaa      1620
     gcgctctata aagcctctca ggcgggtgta aaaatcgaac tcattattcg cggaatctgc      1680
     tgtcttcgtc ctggggttcc gggtgtgagt gaaaacattc gtgtcatctc gctcatcgga      1740
     aaatacctcg aacacgcccg tatctattat ttcaaacact caacgccgca aacctatatc      1800
     tcgagtgccg actggatgcc gcggaatctt ttgcgacgca tcgagttgct cacgccgatt      1860
     caaggagaag agatcagtaa caaactgatt caaattttac agcttcagac atcggacaat      1920
     attctcgcat acgaactgca aaacgacggc agctacgtca aagtgaaaca tgagcccggc      1980
     aatctgatcg atagtcataa aatcgctgaa acccatacca acaaagtgta taattcggtc      2040
     aaaaaacaga ctccgaatta tgtccagcag cttacggcac ggctattcaa agagagttaa      2100
//

If you have problems or comments...

PBIL Back to PBIL home page