(data stored in ACNUC7421 zone)

EMBL: CP002355.PE488

CP002355.PE488       Location/Qualifiers
FT   CDS_pept        472366..472953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0489"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR001440: IPR019734: IPR013026; KEGG:
FT                   tdn:Suden_0443 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33156"
FT                   /db_xref="GOA:E4TZZ1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ1"
FT                   /protein_id="ADR33156.1"
FT                   /translation="MSIFQILMFAATLFFAYQIFRHVQNLDDAQPHKKESNIVDTAVFS
FT                   ASALVEEADNAYQRGELDRARTALEEASRIESENPEILNKLAFITAKTGDRLKAIELYE
FT                   QSLELDENDDLTHNAIASLYRAENAYERAQDHYLKAIEIDDTYPQTFYNYANLLVDMDE
FT                   VEKARGMYKRALELQSDFPEAREALLSLGAHV"
     atgtctatat ttcaaatttt aatgtttgcg gcgacccttt ttttcgccta tcagatcttt        60
     cggcacgttc aaaacctgga cgatgctcag cctcacaaaa aggaatctaa tatcgtcgat       120
     acggctgttt tcagtgcttc ggctttggtt gaagaggccg ataacgctta tcagcgcggc       180
     gagttagatc gtgccagaac cgctcttgaa gaggcatcgc gtatcgagag cgaaaatcct       240
     gagattttaa ataaactcgc atttatcact gcaaaaacgg gtgatcggct taaagcgata       300
     gaactgtatg aacaatcgtt ggaactcgat gaaaacgatg acctgaccca taatgccatc       360
     gcttcgcttt accgtgcgga aaatgcatac gagcgtgcac aggaccatta cctcaaagcc       420
     attgaaattg atgatacgta tccccagacg ttttacaact acgccaatct attggttgat       480
     atggatgagg ttgagaaggc cagaggaatg tacaagcgcg ctcttgagct ccaaagcgat       540
     tttccggaag cgcgcgaagc gcttctttca ttaggagcac acgtatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page