(data stored in ACNUC7421 zone)

EMBL: CP002355.PE489

CP002355.PE489       Location/Qualifiers
FT   CDS_pept        472950..473690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0490"
FT                   /product="protein of unknown function DUF88"
FT                   /note="KEGG: mmh:Mmah_0289 protein of unknown function
FT                   DUF88; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33157"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ2"
FT                   /protein_id="ADR33157.1"
FT                   /translation="MIDDQARLAVLIDADNSQPSIIAGLMDEIAAHGIASVKRIYGDWT
FT                   DTKLKGWKNALLEHGLHPMQQFAYTTGKNATDSAMIIDAMDLLYTKNFDGFCIVSSDSD
FT                   FTRLASRIRESGIKVYGFGEQKTPKAFIGVCDKFIYTENLRRDANHKEPVGTKIKPDNK
FT                   ALLALVRNAVEDTTNEAGWSYLGSIGQNLINKSPEFDPRSYGFKKLLDLIESLGEFEFK
FT                   FSDPLSGSQAVHVRLKRHKRSYEK"
     atgattgatg atcaggcccg tctcgccgta ttaatcgatg cggacaactc tcagccctcc        60
     attatcgccg ggcttatgga tgagattgcc gctcacggca ttgccagcgt caagcgcatt       120
     tacggcgact ggaccgatac gaaactgaaa ggatggaaaa atgcccttct cgaacatggg       180
     cttcatccga tgcagcagtt tgcctatacg acgggaaaaa atgcgaccga cagcgccatg       240
     atcatcgatg cgatggatct gctctatacg aaaaactttg acggtttctg tatcgtctcc       300
     agtgacagcg attttacccg tctggcgagc cgtatccgcg aatcggggat caaagtctac       360
     ggattcgggg agcaaaaaac acccaaagcg tttatcggcg tgtgcgacaa attcatttac       420
     accgaaaacc ttcgccgaga cgctaatcat aaagagccgg tcgggacaaa aatcaaaccg       480
     gacaataaag cccttttggc tttggtgcgc aacgcggtcg aggatacgac caatgaagcg       540
     ggatggtcgt atctgggctc catcggacaa aatcttatca acaaatcccc cgagttcgat       600
     ccccgaagct acggcttcaa aaaactcctt gatttgattg aaagtctggg ggaatttgag       660
     tttaaatttt ccgatcccct ttcgggttcg caggcggtac atgtcaggct gaaacggcac       720
     aaaaggagtt atgagaaatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page