(data stored in ACNUC7421 zone)

EMBL: CP002355.PE49

CP002355.PE49        Location/Qualifiers
FT   CDS_pept        47719..47988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0049"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="COGs: COG1987 Flagellar biosynthesis pathway
FT                   component FliQ; InterPro IPR006305: IPR002191; KEGG:
FT                   tdn:Suden_2005 flagellar biosynthesis protein FliQ; PFAM:
FT                   export protein FliQ family 3; SPTR: Flagellar biosynthesis
FT                   protein FliQ; TIGRFAM: flagellar biosynthetic protein FliQ;
FT                   PFAM: Bacterial export proteins, family 3; TIGRFAM:
FT                   flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32717"
FT                   /db_xref="GOA:E4TWA1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA1"
FT                   /protein_id="ADR32717.1"
FT                   /translation="MVQSELIGLGIETFKIALILSLPALLVGMFLGLAVSIFQATTQIN
FT                   EMTLSFIPKIIGIVVVIILTMPWMMNEMQDFTIRMFNLIPTFMQ"
     atggttcaat cggaattgat cggcttaggg atcgaaacgt ttaaaatcgc cctcattttg        60
     tccctgccgg cattattagt cgggatgttt ttgggtcttg cggtgagtat ttttcaagcg       120
     actacccaaa tcaatgagat gaccctcagc tttatcccga aaatcatcgg gattgttgtc       180
     gtcattatcc tcacgatgcc gtggatgatg aatgagatgc aggattttac gatccgcatg       240
     tttaatctga tccctacctt tatgcagtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page