(data stored in ACNUC7421 zone)

EMBL: CP002355.PE490

CP002355.PE490       Location/Qualifiers
FT   CDS_pept        473687..474409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0491"
FT                   /product="protein of unknown function DUF34"
FT                   /note="COGs: COG0327 conserved hypothetical protein;
FT                   InterPro IPR002678; KEGG: tdn:Suden_0444 hypothetical
FT                   protein; PFAM: protein of unknown function DUF34; SPTR:
FT                   Putative uncharacterized protein; PFAM: NIF3 (NGG1p
FT                   interacting factor 3); TIGRFAM: dinuclear metal center
FT                   protein, YbgI/SA1388 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33158"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ3"
FT                   /protein_id="ADR33158.1"
FT                   /translation="MTVQEIYTYLDGLSPFATQEGWDNSGLLVGDFAQEITHVVLSIDI
FT                   DEELIETIPENALLITHHPVIFGGLKQLQFNQYPAKILMPLIRKNITNIAMHTNFDQTH
FT                   LNDYVATEVLGYPIIAKEGFVAYLGVDEPYDAFAEKIKTALGLPHTRGVKCHDHIRTCA
FT                   LVTGSGASLMRNIEAECFLTGDIKYHDAMEAKALGLSMIDIGHYESERYFGEVLGGYLE
FT                   KLGLSVIISPSKNPFTYL"
     atgacggtac aggaaattta tacgtatctt gacggacttt ccccattcgc gacgcaggag        60
     ggatgggata attccggtct tttagtcggc gactttgccc aggaaattac gcatgttgtc       120
     ttgagtatcg acattgatga agaattaatc gaaacgattc ccgagaatgc ccttttgatc       180
     acccatcacc cggttatttt cggcggactt aaacagctgc agtttaatca gtatccggct       240
     aagattctta tgcccctgat ccgcaaaaat atcaccaata tcgcgatgca taccaatttc       300
     gaccaaacgc atttgaacga ttacgtcgcg actgaagtcc tcggatatcc cattatcgcc       360
     aaagaggggt ttgtcgcgta tttgggggtg gatgaaccct acgatgcgtt tgccgaaaaa       420
     atcaaaacgg cactggggct tccccatacc cgcggcgtca aatgtcatga tcatatccga       480
     acctgtgctt tggtgaccgg atcgggcgca tccctgatgc gcaatatcga agcggaatgt       540
     tttttgacgg gcgacatcaa atatcatgat gcaatggagg ccaaggcact cggtttatca       600
     atgatcgaca tcggacacta tgagagcgaa cgctattttg gcgaggtttt agggggctat       660
     ttggaaaaat taggattgag tgttataatt tcaccatcta agaacccctt cacctatctt       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page