(data stored in ACNUC7421 zone)

EMBL: CP002355.PE491

CP002355.PE491       Location/Qualifiers
FT   CDS_pept        474449..475171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0492"
FT                   /product="protein of unknown function DUF164"
FT                   /note="COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; InterPro IPR003743; KEGG: tdn:Suden_0445
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF164; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33159"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ4"
FT                   /protein_id="ADR33159.1"
FT                   /translation="MNKHLEQLIELSHVDKEIDAFEPQIEEANLQYDALLATKNSITNE
FT                   INALKQEIKDEQIKKHKNELHLAELSAKLEENSKKSNEVKTEREMKSLQLEEEIAKEQV
FT                   SFANEEIERLEKLIDHKQSKIDELEAKAAEIDGTLAGVKADVDVKLARIDEERKEVFAR
FT                   KEALVGAMNQKGLSFYQKIRRWAKNTTAVAVRNQACMGCYMAISDKVYSDVIKGEEITM
FT                   CPHCGRILFLEPSDAIGA"
     atgaacaaac accttgaaca attaatcgag ctctctcatg ttgataaaga gatcgacgca        60
     tttgaaccgc aaatcgaaga agcgaatctt cagtatgatg cacttttagc gactaaaaac       120
     agtatcacaa atgaaatcaa tgctttgaaa caagagatca aagacgaaca gatcaaaaag       180
     cataaaaatg agcttcattt ggcggaactt tctgcaaaac ttgaagagaa cagcaaaaaa       240
     agcaatgagg taaaaaccga gcgcgaaatg aaatcgcttc aactcgaaga agagattgca       300
     aaagagcaag tgagctttgc gaacgaagag attgagcgat tggaaaaatt gatcgatcac       360
     aaacaaagta aaattgacga gcttgaagca aaagcagctg aaatcgacgg aactcttgca       420
     ggtgtaaaag cggatgtcga tgttaaattg gcacgtatcg atgaagaacg caaagaagtt       480
     tttgcacgca aagaggcgtt ggtaggtgcg atgaaccaaa aagggttgtc attttaccaa       540
     aaaattcgcc gctgggctaa aaacacgact gccgttgcgg tacgtaatca agcgtgtatg       600
     ggatgctata tggcgatcag cgataaagtc tacagtgacg ttatcaaagg cgaagagatc       660
     accatgtgtc ctcactgcgg tcgtatttta tttttagagc cttctgacgc tatcggtgcg       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page