(data stored in ACNUC7421 zone)

EMBL: CP002355.PE492

CP002355.PE492       Location/Qualifiers
FT   CDS_pept        475164..476327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0493"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein"
FT                   /note="COGs: COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase; InterPro IPR007507; KEGG: tdn:Suden_0446
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein; SPTR:
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   3-Deoxy-D-manno-octulosonic-acid transferase
FT                   (kdotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33160"
FT                   /db_xref="GOA:E4TZZ5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ5"
FT                   /protein_id="ADR33160.1"
FT                   /translation="MRNVVFDLIYTLVAAFFYVAALPLLILFSFKKKYRDSIPARFFGI
FT                   KNPPFQPHDIWFHVCSFGEAKAIAPVLEKLKDKKIAISVITHTGYEAASKYAAQVRYLP
FT                   YELWLWFWIERPKTVVVLEAEFWYLLFRLASRRGARVIALNARISDRSFSKYYRMRWFY
FT                   RILLSQCDRVFCQSSEDMVRFIALGARNVEVVGNIKLAQKIESNKHYPKPNGLLIVAAS
FT                   THEGEEEGIIRGFMAYREHNPSAKLLVVPRHPERFAKVGELIAKTAPKMTLSRWSESQM
FT                   ITEDITLIDTMGDLNNLYAISDVVVLGGAYAPIGGHNPLEPATFGCRIISGMEIFHQRE
FT                   LFKYVSHVQFTSVEGIAEALKNAETMPPSQINGSVDLKKVLNYLTEK"
     gtgcgtaacg tagtattcga cctgatttat acactggttg cggcgttttt ttacgtcgcg        60
     gccctgcctc ttttaatcct cttttcgttt aaaaagaaat atcgcgattc aattccggca       120
     cgctttttcg gcattaaaaa tcccccgttt caacctcatg acatttggtt tcatgtgtgt       180
     tcattcgggg aagcaaaagc aatcgctcca gttttggaga aattgaaaga taaaaaaatc       240
     gcgatcagtg ttattaccca tacgggatat gaggcggcgt cgaagtatgc ggctcaggta       300
     cgttacctgc cgtatgagtt atggctgtgg ttttggatcg agcgtcccaa aaccgttgtg       360
     gtcctggaag cggagttttg gtatctgctg tttcgtttag cttcgagaag aggcgctcgc       420
     gttattgcac tcaacgctcg gataagcgat cgaagtttct cgaagtatta ccggatgcga       480
     tggttttatc ggattttatt atcgcaatgc gatcgtgtct tttgccaaag cagcgaggat       540
     atggtccgtt ttatcgcact gggtgccagg aatgtcgaag tcgtcggaaa tatcaagctt       600
     gctcaaaaaa tcgagtcgaa taaacactat ccgaagccta atggattgct tatcgttgcc       660
     gcaagtaccc atgaggggga agaggagggg ataattcggg gatttatggc atatcgtgag       720
     cataacccct ccgccaaact tttggtggtt ccgcgtcacc ccgagcggtt tgccaaagta       780
     ggagagttga ttgcgaaaac ggcaccgaag atgactcttt cacgttggag tgaatcgcaa       840
     atgattacgg aggatattac ccttatcgat acgatgggag acttgaataa tctctacgcc       900
     ataagtgatg tagtggtgtt ggggggtgct tacgctccta tcggggggca taatccgctg       960
     gaacctgcga cattcggatg taggatcatt tcggggatgg agatatttca ccagagggaa      1020
     ctgtttaaat atgtctctca cgtgcagttt acgtcagtgg aggggattgc ggaagcattg      1080
     aaaaatgctg aaacgatgcc cccgtcacag attaacggaa gcgttgatct gaaaaaagta      1140
     ctcaattatt taacggagaa ataa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page