(data stored in ACNUC7421 zone)

EMBL: CP002355.PE494

CP002355.PE494       Location/Qualifiers
FT   CDS_pept        477403..478749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0495"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004780: IPR013822: IPR000897: IPR004125: IPR
FT                   003593; KEGG: tdn:Suden_0450 signal recognition particle
FT                   protein; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; GTP-binding signal recognition particle
FT                   SRP54 helical bundle; Signal peptide binding (SRP54) M-
FT                   domain protein; SMART: AAA ATPase; SPTR: Signal recognition
FT                   particle protein; TIGRFAM: signal recognition particle
FT                   protein; PFAM: SRP54-type protein, GTPase domain;
FT                   SRP54-type protein, helical bundle domain; Signal peptide
FT                   binding domain; TIGRFAM: signal recognition particle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33162"
FT                   /db_xref="GOA:E4TZZ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ7"
FT                   /protein_id="ADR33162.1"
FT                   /translation="MFDTLTESFTSAIRKIRFHDDEKALTKALGELKKALLKADVNHKV
FT                   VKELIDSVEIQTKQNGVGKDQFLDALRKSLYALLDVKGKSGFVYAPVAPTVILMTGLQG
FT                   SGKTTTTGKLANWLKTRQKKRVLVVAADLQRLAAVEQLRQVCGAIDVELYADDATKNPV
FT                   EVVKAALEHAKKVLVDVVLIDTAGRLAIDDELMGELAEVKAVANPHEIFYVADSLSGQD
FT                   AVRTAATFNEKIGIDGVILTKYDGDSKGGVALGIASQIQVPLRFIGAGEKMEDLEIFLP
FT                   DRIVNRLMGLGDIEGLAERTASVIDEKKAKALTKKIKKGEFNFNDFLEQMESLKKMGSM
FT                   KSIMGMIPGMGGMASALKDFDLENSTQLKQIKALVSSMTVKEREDPELLNNSRKARLAK
FT                   GCGLDIIEVNRILKQFKNASKMAKRFSGKQGMKDLQSMMGQMQGARLPR"
     gtgtttgata cactaaccga atcgtttaca tcagccatac gaaaaatccg ttttcacgat        60
     gatgaaaagg cgttgaccaa ggcactcggc gagcttaaaa aagcgctttt gaaagccgat       120
     gtaaatcaca aggtcgttaa agaactgatc gattcggttg agattcaaac caaacaaaac       180
     ggtgtcggga aagatcaatt cctcgatgct cttcgaaaat cgctctatgc ccttttggat       240
     gtcaaaggta aatcgggatt tgtctacgct ccggtagctc cgaccgtcat tttgatgacc       300
     ggtctgcagg gttcgggtaa aacgacgaca accggaaaat tggcgaactg gcttaaaacg       360
     cgtcagaaaa aacgggtttt ggtcgttgcg gccgacttgc agcgtctagc ggcggttgag       420
     cagcttcgtc aagtgtgcgg agccatcgat gtcgaacttt atgccgatga tgcgacaaaa       480
     aatccggttg aagtggtcaa agcagcactt gaacatgcaa aaaaagtgtt agtcgatgtc       540
     gtattgatcg atacggcggg gcggcttgca atcgatgatg aactgatggg agagttggcg       600
     gaagtcaaag cggttgccaa tccgcatgag attttctatg tggccgactc tctcagcggt       660
     caggatgcgg tccgtaccgc cgcgacgttt aacgaaaaga tcggaatcga cggtgttatc       720
     ctcaccaaat acgacggtga ttccaaaggg ggcgtggctt taggtatcgc ttctcagatt       780
     caggtaccgc ttcgctttat cggtgcgggt gaaaaaatgg aagatctcga aatcttcctc       840
     cctgatcgta tcgtcaaccg tcttatggga ttgggtgata tcgaaggtct tgccgagcgc       900
     accgcgtcgg taatcgacga gaaaaaagcg aaagctttga ccaaaaaaat caaaaaaggg       960
     gagttcaatt ttaacgactt cctggagcag atggaaagcc tcaaaaaaat ggggagcatg      1020
     aaatcgatta tgggtatgat ccccggaatg ggcggcatgg cttcggcgct caaagatttc      1080
     gatttggaaa attcgacgca gctcaaacag atcaaagctc tggtgtcgtc tatgacggtg      1140
     aaagagcgcg aagatccgga actcttgaat aacagccgta aagcccgttt ggcaaaaggg      1200
     tgcggcttgg atatcatcga agtgaaccgt attttgaaac agttcaaaaa tgcctctaaa      1260
     atggcaaaac ggttctcagg aaaacagggg atgaaggacc ttcagagcat gatgggtcaa      1320
     atgcagggtg cgcgtttacc gcgttaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page