(data stored in ACNUC7421 zone)

EMBL: CP002355.PE497

CP002355.PE497       Location/Qualifiers
FT   CDS_pept        479351..479905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0498"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro IPR011961: IPR002676: IPR007903; KEGG:
FT                   tdn:Suden_0453 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein; SPTR: Ribosome
FT                   maturation factor rimM; TIGRFAM: 16S rRNA processing
FT                   protein RimM; PFAM: RimM N-terminal domain; TIGRFAM: 16S
FT                   rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33165"
FT                   /db_xref="GOA:E4U000"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E4U000"
FT                   /protein_id="ADR33165.1"
FT                   /translation="MSNRFRNSPSHDLLHVATLGRTVGLKGDMKLNLSTDFPEQFIPNA
FT                   TFTLDNGKEVTLSSYNPDRELVHLKGIDTPEAAKALTNAKLFTTFEATRERCNLGEGEF
FT                   FWFDLLGSKVVEGESVLGKVQEIERIGPLDYLLVATDPSLVSKGMAATFLIPYIDRFVL
FT                   GTDATAKVITVEGGLDLLEAS"
     atgtcgaacc gctttcgtaa ttcaccttcg cacgatttgc tccatgtcgc cactttgggc        60
     cgcactgtcg gtctaaaggg ggacatgaaa ctcaatctct ccactgattt ccctgaacag       120
     tttattccca atgccacctt cactcttgat aacggcaaag aggtaactct ctcttcgtat       180
     aaccccgatc gagaactcgt tcatcttaaa gggatcgata cgcccgaagc ggctaaggca       240
     ttgaccaatg cgaaactctt taccactttt gaggcgacgc gtgagcggtg caacttggga       300
     gaaggggagt ttttctggtt cgatcttctc ggctctaagg tcgtagaggg tgaatcggtt       360
     ttgggaaaag ttcaggagat cgagcggatc ggaccgttgg attatctgtt ggtcgcaacc       420
     gatccttctt tggtttccaa agggatggcg gctacctttt taatccccta cattgaccgt       480
     tttgttctag gcaccgatgc aaccgcaaaa gtgataaccg tagagggcgg attggatctg       540
     ctggaagcgt cataa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page