(data stored in ACNUC7421 zone)

EMBL: CP002355.PE5

CP002355.PE5         Location/Qualifiers
FT   CDS_pept        6616..7005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0005"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="COGs: COG0780 Enzyme related to GTP cyclohydrolase
FT                   I; InterPro IPR016856: IPR020602; KEGG: tdn:Suden_0004
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase; PRIAM: PreQ(1) synthase; SPTR:
FT                   NADPH-dependent 7-cyano-7-deazaguanine reductase; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I; TIGRFAM: 7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32673"
FT                   /db_xref="GOA:E4TW57"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW57"
FT                   /protein_id="ADR32673.1"
FT                   /translation="MKYGEQIVENFDVEKDFEIWPNQHERDYVIKVTLPEFTCLCPRSG
FT                   YPDFATIYVEYTPDKWVAELKAIKLYINSFRNRHISHENSANEIYSVFEQKIAPKRLKV
FT                   VADYYPRGNVHTVVEIDSEKMVKEK"
     atgaaatacg gcgagcagat agtcgaaaat ttcgatgtag aaaaagattt tgagatttgg        60
     cctaaccagc atgagcgcga ttatgtcata aaagtaacgt tacccgaatt tacctgtctt       120
     tgtccgcgca gcggatatcc cgattttgca acgatttatg tcgaatatac tccggataaa       180
     tgggttgctg aactcaaagc tatcaaactg tacattaatt cgttcagaaa ccgccatatt       240
     tcgcacgaaa acagtgcaaa cgagatttac agcgtctttg aacagaaaat cgctcctaag       300
     cgcttaaaag tggttgcaga ctattatccg cgcggaaatg ttcatacggt cgtggaaatc       360
     gatagtgaaa agatggtaaa agagaagtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page