(data stored in ACNUC7421 zone)

EMBL: CP002355.PE50

CP002355.PE50        Location/Qualifiers
FT   CDS_pept        48100..48888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0050"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="COGs: COG0812 UDP-N-acetylmuramate dehydrogenase;
FT                   InterPro IPR003170: IPR011601; KEGG: tdn:Suden_2006
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein; SPTR:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal
FT                   domain; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32718"
FT                   /db_xref="GOA:E4TWA2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA2"
FT                   /protein_id="ADR32718.1"
FT                   /translation="MLNTKTIDFSKFSSIRIGPIVEVALIENDVVPEGHMIVGSANNVL
FT                   ISPTPPPLMILSKEYDFIRLEDDGLHIGAATPGGRVVSFCKKNDIAHFEYLSKLPGTLG
FT                   GMLKMNAGLKEYEIFNHLIAIRTMSGWKQKNEIEFGYRKTSIHEVVFEAVFEVHPGYSN
FT                   ERYEMFSQMRSNQPNDPSAGSCFKNPPGDYAGRLIEAVGLKGVRQGSMAFSEVHANFLV
FT                   NTGGGTYSDALTLIHEAQKRIKEQFDIDLQCEIVLIDQKI"
     ttgctaaaca ccaaaactat cgatttttcc aaattcagct ccattcgaat cggccccatc        60
     gtcgaggtag cgctcatcga aaacgatgtt gtccccgagg ggcatatgat cgtcggttcc       120
     gctaacaacg tcctcatctc tcccactccg ccgccgctga tgatcctctc caaagagtac       180
     gattttatcc gccttgaaga cgacgggctc catatcggtg cggcaacccc cggaggacgg       240
     gtcgtctctt tctgcaaaaa gaacgacatc gcccatttcg aatacctctc caaactcccc       300
     ggaacactcg gcggaatgct gaagatgaat gcgggactga aagagtatga aatctttaac       360
     catctgatcg ccatccgcac gatgagcggc tggaagcaaa aaaacgaaat cgaattcggc       420
     taccgaaaaa cctccattca tgaagtcgtt tttgaagcag tattcgaagt gcacccaggc       480
     tactcaaacg aacggtatga gatgttttct cagatgcgtt ccaatcagcc caatgacccg       540
     agcgcgggaa gctgttttaa aaatcctccg ggggattatg ccgggcgact gatcgaagcg       600
     gtcgggttaa aaggggtacg ccagggctcc atggcattta gcgaagtgca tgccaatttt       660
     ctcgtcaaca cgggaggtgg aacctacagc gatgcgctga ccctcataca tgaggcacaa       720
     aagcggataa aagagcagtt tgacatcgat cttcaatgcg aaatagtact gattgatcaa       780
     aaaatatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page