(data stored in ACNUC7421 zone)

EMBL: CP002355.PE500

CP002355.PE500       Location/Qualifiers
FT   CDS_pept        complement(481035..481487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0501"
FT                   /product="SsrA-binding protein"
FT                   /note="COGs: COG0691 tmRNA-binding protein; InterPro
FT                   IPR000037: IPR020081; KEGG: tdn:Suden_0441 SsrA-binding
FT                   protein; PFAM: SmpB protein; SPTR: SsrA-binding protein;
FT                   TIGRFAM: SsrA-binding protein; PFAM: SmpB protein; TIGRFAM:
FT                   SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33168"
FT                   /db_xref="GOA:E4U003"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E4U003"
FT                   /protein_id="ADR33168.1"
FT                   /translation="MGENIATNKKAFFDYYIEEKFEAGLVLKGSEVKSLRAGRVNLKDG
FT                   FIKIVRGEAFVFGVHIGVLDTTHRFYAHEERGSRKLLLHKKQIDKMFKAVEKEGFTLVP
FT                   LSIYFNDRNIAKMQVAIVKGKKLYDKRDDLKEKSIKRDIERALKGE"
     gtgggcgaaa atatagccac taataaaaaa gctttttttg actactacat cgaagagaaa        60
     ttcgaagcgg gtctcgttct caaaggctct gaagtcaaat cgctccgcgc cggacgggtc       120
     aatctcaaag acggctttat caaaatcgta cggggcgaag cgttcgtatt cggcgttcat       180
     atcggagtcc tcgatacgac acaccgattt tatgcccacg aagagcgggg aagccgcaaa       240
     ttgctcctcc ataaaaaaca gatcgacaag atgttcaaag cggtcgagaa agagggattt       300
     acccttgtgc cgctcagcat ctatttcaat gaccgaaata tcgccaaaat gcaggttgcg       360
     atcgtcaaag gaaaaaagct ctatgacaaa cgtgacgacc tgaaagagaa aagtattaaa       420
     cgggatattg aacgggcatt aaaaggggaa tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page