(data stored in ACNUC7421 zone)

EMBL: CP002355.PE501

CP002355.PE501       Location/Qualifiers
FT   CDS_pept        complement(481535..481825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0548 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33169"
FT                   /db_xref="UniProtKB/TrEMBL:E4U004"
FT                   /protein_id="ADR33169.1"
FT                   /translation="MKNEPIYLDQEENELLNEIENGEWVSNPLSPQERQAYQNNAKYTK
FT                   SLQEKRQTTIRFSVSDLAVIKAKSKEMGIGYQNLIQALVHNYAVGKIKLEA"
     atgaaaaatg aaccgatcta cctcgaccaa gaggaaaatg agcttctaaa cgaaatagaa        60
     aacggagagt gggtcagcaa tcccctctcg ccgcaagagc gccaagcgta tcaaaacaat       120
     gcgaaataca ccaaatcttt gcaggaaaaa cgacaaacta ctatccgctt ctccgtcagc       180
     gatttagcgg ttattaaagc caagtccaaa gagatgggga tcggatatca aaacctaatc       240
     caagccttag tccataatta cgcagtaggt aaaatcaaac tcgaagccta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page