(data stored in ACNUC7421 zone)

EMBL: CP002355.PE502

CP002355.PE502       Location/Qualifiers
FT   CDS_pept        complement(481815..482102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0547 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33170"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:E4U005"
FT                   /protein_id="ADR33170.1"
FT                   /translation="MSKIIRWNEEKNQLLQLQRNISFEQVLEKIEKDEIIERYIHPNTE
FT                   KYPNQQIFVIEIDEYIWYVPFVETEEEIFLKSIIPSRKLNAAYGGTKNEK"
     atgtccaaaa ttattcgttg gaatgaagag aaaaaccaac tcctccaact ccaacgaaat        60
     atcagttttg aacaggtatt ggagaagatc gagaaagatg agatcatcga acgatatatc       120
     catcctaata cggaaaagta tcctaaccaa cagattttcg tcatcgaaat tgatgaatat       180
     atctggtatg tcccttttgt cgaaacagaa gaggaaatat ttttaaaatc gattattccc       240
     agccgaaaac tgaatgctgc ttacggaggc acaaaaaatg aaaaatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page