(data stored in ACNUC7421 zone)

EMBL: CP002355.PE503

CP002355.PE503       Location/Qualifiers
FT   CDS_pept        complement(482250..483002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0504"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="InterPro IPR005534; KEGG: sul:SYO3AOP1_0256
FT                   hypothetical protein; PFAM: Curli production
FT                   assembly/transport component CsgG; SPTR: Putative
FT                   uncharacterized protein; PFAM: Curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33171"
FT                   /db_xref="GOA:E4U006"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E4U006"
FT                   /protein_id="ADR33171.1"
FT                   /translation="MNKITIGVIILAMCATLATADENTKVQEIAVPVNKCEAPTLSIAI
FT                   NDIECKAQSCQDTGVPSGGFAALAALASGQGNVKGIGTGVKSMLTNAIKESKCFKIVDL
FT                   EQFEKMKKMLAATGQEVKPPKIDLIISGTISSVDVSKEGGAIAGGVIPIVGLFSKNTSK
FT                   ASIGVEFFTMNPSTLEMGDSKSFKADSEKSSWGFGGFGGAAGGGWSVTKNVALDNVIRD
FT                   VVFSATNYITESYAKDKIVERPKLVAAQ"
     atgaataaaa tcacaatagg tgttataatt cttgccatgt gcgcaacact ggctacagca        60
     gatgaaaaca caaaagttca agagatcgct gtgccagtca ataagtgtga agcacctacc       120
     ctttctatag caatcaacga tatcgaatgc aaagcgcagt cctgtcaaga cactggtgtc       180
     ccaagtggcg gtttcgccgc tttagctgca ttggcaagtg gtcagggaaa tgttaaagga       240
     ataggaacag gcgtaaaaag catgttgaca aatgctatta aagagagcaa atgtttcaaa       300
     attgtcgatt tggaacaatt tgagaaaatg aaaaaaatgt tagcagctac aggtcaagag       360
     gtcaaacctc ctaaaattga cttaattatt agtggtacca tttcatcggt tgatgtcagt       420
     aaagagggtg gagcaattgc tggtggagtt attcctatcg tagggctttt cagtaaaaac       480
     acctctaaag ccagtattgg tgtcgaattt ttcactatga acccgtcaac tttggaaatg       540
     ggtgactcaa aaagcttcaa agcagatagc gaaaaaagtt catggggatt tggaggtttc       600
     ggtggagctg ctggcggagg atggagcgtt actaaaaatg tagctcttga taatgttatt       660
     cgcgatgttg tattcagtgc aacaaactac atcacagaat cttacgctaa agataaaatc       720
     gtagaaagac ctaaactggt cgcagctcaa taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page