(data stored in ACNUC7421 zone)

EMBL: CP002355.PE504

CP002355.PE504       Location/Qualifiers
FT   CDS_pept        complement(483273..484034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0505"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424: IPR006204; KEGG:
FT                   tdn:Suden_0440 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; SPTR:
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33172"
FT                   /db_xref="GOA:E4U007"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4U007"
FT                   /protein_id="ADR33172.1"
FT                   /translation="MIRYRAYAKVNIFLKITGMRGEYHTLSSRFMRVKDLFDTLWFEEK
FT                   ATPEFEIRGSFDCEVHANTIYKAYKHLLAVTRSDKLSSFFESHAVCVDKKIPSFAGLGG
FT                   GSSDAATFLTMCNEELELGLSLNELAEIASHIGADVPFFVYGYESANVSGIGEVVERFD
FT                   EPLIDFEVVTPDIQISTPSVYRYYREHLYAPISAEEAARLESTPSRDILAFMSPKEAND
FT                   LYPSALACYSELSEKEGWFFSGSGSSFFRIK"
     atgatccgtt accgtgccta cgccaaagtc aatattttcc ttaaaattac cgggatgcgg        60
     ggagagtatc atacgctgag ttcccggttt atgcgggtaa aagacctctt tgataccctc       120
     tggtttgaag aaaaagctac tcccgagttt gaaatacggg gaagctttga ctgtgaagtc       180
     catgccaata ccatctataa agcgtataaa catcttctcg ccgttacccg ctcggataaa       240
     ctctcctcct tttttgagag ccatgccgta tgcgtcgaca aaaaaatccc ctctttcgcc       300
     ggccttgggg gaggcagttc cgatgccgca acttttttaa cgatgtgcaa cgaggagctg       360
     gagctcgggc tgagtctcaa cgaacttgct gaaatcgctt cccatatcgg tgccgatgtc       420
     ccctttttcg tttacggcta tgagtctgcc aatgtcagcg gtatcggaga ggttgttgag       480
     cgctttgatg aaccgttgat tgatttcgaa gtggttacac ccgacataca gatcagcacc       540
     ccctctgtct accgctacta tcgcgagcat ctttacgcgc cgataagcgc tgaagaagcc       600
     gctaggttag aatcgacccc gtcacgtgat attctcgctt tcatgagtcc caaagaggcc       660
     aatgaccttt atccctccgc tcttgcgtgc tacagcgaac tttccgaaaa agagggttgg       720
     tttttctccg gcagcggaag cagttttttt agaatcaaat ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page