(data stored in ACNUC7421 zone)

EMBL: CP002355.PE506

CP002355.PE506       Location/Qualifiers
FT   CDS_pept        complement(484255..485076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0507"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR002501; KEGG: sdl:Sdel_1632 pseudouridylate synthase
FT                   TruB domain protein; PFAM: pseudouridylate synthase TruB
FT                   domain protein; SPTR: tRNA pseudouridine synthase B; PFAM:
FT                   TruB family pseudouridylate synthase (N terminal domain);
FT                   TIGRFAM: tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33174"
FT                   /db_xref="GOA:E4U009"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E4U009"
FT                   /protein_id="ADR33174.1"
FT                   /translation="MNRLFVAYKPSGISSNQLLGRLKRKYGVKKAGYSGTLDPFAKGVL
FT                   IIAFGNHGRLFRFLNKTPKRYRATLWLGAYSPTLDIEKIETIDEIQPVSVEQIEAIFAS
FT                   LVGELTYLPPKYSAKRIEGRRAYELAREGKEVDLRAITSTIYDLTFKHYCHPFVTFEAT
FT                   VSEGSYIRSLGEIIAEHLGCNGALTALERLNEGQFIFENEKELDIKSSLALTKNRYNGT
FT                   LQTMLLGQPLLREDFEIQEEGTYWIDNGDTISILEITPEGVRYILNKVEAC"
     atgaatcgtc tcttcgttgc ctacaaaccc tccggtatta gttccaacca gctgctcggc        60
     agactaaaac gcaaatacgg cgttaaaaaa gcgggctatt ccggcactct cgatccgttt       120
     gccaaagggg tcttgatcat cgcattcgga aaccacggac gtctgtttcg ttttttaaac       180
     aaaaccccga aacgctaccg ggccactctt tggctgggag cctactcccc gaccctcgat       240
     atcgaaaaaa ttgaaaccat agatgaaatc caacctgtca gtgtagaaca aatcgaggct       300
     atttttgctt ctcttgtcgg agagctcacc tatctgcccc ctaaatacag tgccaagcgg       360
     attgaggggc gcagagccta cgaattggcc cgtgagggga aagaggttga tttacgcgcc       420
     atcacttcga cgatctatga ccttaccttc aaacactatt gccacccctt tgtcaccttt       480
     gaagcgaccg tatcggaagg gagctatatc cgctcactcg gtgaaattat tgccgaacat       540
     cttggatgca acggtgcgct cactgcgttg gaacgcctta atgaggggca attcattttc       600
     gaaaatgaaa aagagctcga tattaaatct tcccttgcgc taaccaaaaa ccgctataat       660
     ggcacattgc aaacgatgct tttaggacag ccccttcttc gtgaagattt cgagattcaa       720
     gaagagggaa cctactggat cgacaacggc gacactatct cgatactgga gatcaccccc       780
     gagggtgtcc gttatattct caataaggtt gaagcatgct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page