(data stored in ACNUC7421 zone)

EMBL: CP002355.PE508

CP002355.PE508       Location/Qualifiers
FT   CDS_pept        487296..488195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0509"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847: IPR005119; KEGG: tdn:Suden_0436 LysR family
FT                   transcriptional regulator; PFAM: regulatory protein LysR;
FT                   LysR substrate-binding; SPTR: Transcriptional regulator,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33176"
FT                   /db_xref="GOA:E4U011"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4U011"
FT                   /protein_id="ADR33176.1"
FT                   /translation="MLKDFAKLMTFLTVVREKSFSKASAKLGISQPAVTQQIKFIEDYL
FT                   DTRVVERKKNGIKLTKEGEDLYRIATKLEKAIQVSEKEVLKIINKEFTFIVGASYAIGN
FT                   YVLPSYIGQLKDKINNEVHIRVAFSEEIIDQLLDKKIDIALIESPVFKDGLIYREWEED
FT                   ELVIFSNQPIPKQLRKEDMYKFDWICRDENSHTRKLTSEVFEEIGVECSSFSVIGVVAS
FT                   STAIKETLMRSPKDAARPVVSVISRHVISDEVEEGKLFEARIKNYKIKRKFYIVYSKER
FT                   KHDAFIDNVVTYLLGLKL"
     atgttaaaag attttgccaa actaatgacg tttctgacgg tagtgcggga aaaaagtttt        60
     tcgaaagctt cggcaaaact cggcatctct cagcctgcgg taacgcagca aatcaaattt       120
     atcgaagatt acctcgatac ccgtgtggtc gaacgcaaaa agaacgggat taaactgacc       180
     aaagaggggg aagaccttta ccgcatcgca acaaaactgg aaaaagcgat tcaggtttcc       240
     gaaaaagagg tcttaaagat cattaacaaa gagttcacct ttattgtcgg cgcatcgtat       300
     gcgatcggta actatgtcct cccttcctat atcgggcagc ttaaagacaa gatcaataac       360
     gaagttcata tccgtgttgc attttcggag gagattatcg atcagctttt ggataaaaag       420
     atcgatatcg cactcatcga atcgccggta tttaaagacg ggttgatcta ccgcgaatgg       480
     gaagaagacg aattggttat tttctcgaac cagccgatcc cgaaacagct tcgcaaagaa       540
     gatatgtata aatttgactg gatctgccgt gatgagaact cacacacccg caaattgacc       600
     tccgaagtct tcgaagagat cggagtcgag tgttcaagtt tcagcgtaat cggtgtggtt       660
     gccagctcaa cggcgatcaa agagacattg atgcgctcgc cgaaagatgc ggcgcgtccg       720
     gtcgtatcgg tcatttcgcg tcatgttatc agtgatgagg tggaagaggg taaactgttt       780
     gaggcgcgga tcaaaaacta caaaatcaaa cgcaagtttt acatcgtcta cagcaaagag       840
     cgtaagcacg acgcctttat cgacaacgtc gtcacatatc tgctgggatt aaaactgtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page