(data stored in ACNUC7421 zone)

EMBL: CP002355.PE509

CP002355.PE509       Location/Qualifiers
FT   CDS_pept        complement(488306..488767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0435 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33177"
FT                   /db_xref="UniProtKB/TrEMBL:E4U012"
FT                   /protein_id="ADR33177.1"
FT                   /translation="MLFDIIKSSSFARLMENHIREMLIYLFENDQNFGILCKIEHVTFD
FT                   PPLPKHLNDEFRSMTLFFLAGYTFESARIENDTLIFEAGFGQENIGSFVSVPLLSIVQI
FT                   IVDDTPAFVNLALPQEQHPIVNIEKHEGVQNSMSALLSNPENQKFLKKK"
     atgttattcg acattattaa aagctcctca tttgcacgat tgatggaaaa tcatatccgt        60
     gaaatgctta tttatctttt tgagaatgac cagaatttcg gtattttatg caagatcgaa       120
     cacgttacgt tcgatccccc tctcccgaaa catctcaatg acgaatttcg atctatgacc       180
     ctcttctttt tagccggata caccttcgaa agcgcccgta tcgaaaacga tacacttatc       240
     ttcgaagcgg gattcggtca agagaatatc ggcagttttg tctccgtacc gctcctctcc       300
     attgtccaaa tcatcgtgga tgacacaccg gcatttgtca atctggcact cccgcaagag       360
     cagcatccca ttgttaatat cgaaaagcac gaaggggttc agaactcaat gagcgccctg       420
     ctctcgaacc ctgaaaatca gaagtttttg aagaaaaaat ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page