(data stored in ACNUC7421 zone)

EMBL: CP002355.PE51

CP002355.PE51        Location/Qualifiers
FT   CDS_pept        48978..49640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0071 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Resolvase, N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32719"
FT                   /db_xref="GOA:E4TWA3"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA3"
FT                   /protein_id="ADR32719.1"
FT                   /translation="MTVSYIRPDKDFDGVYEQLKLINGYADQKGIAINEEMVDQTSQNK
FT                   RLSERHEVVRFFRSLDGDTLIIYDTWTLSSCIEDVVQMFSCLLKNNNTLHFVKPGVIID
FT                   RKSDTMVVLGLIDQLRQILQDDAKKGIGRPRGSKSSSKFDIHLEQIIDLLKKRRSVSEI
FT                   ARVLDVSRSSLKDYIESRELKEVVNGVIGIGNDEDAEATVIGTIRCPIDESQKRENI"
     atgacggtaa gttatatccg accggataaa gattttgacg gtgtttatga gcagcttaaa        60
     ttgatcaacg gttatgccga tcagaagggg atagccatca atgaagagat ggtggatcag       120
     acttcccaga ataagcggct gagtgaacgt catgaagtcg tccgtttctt ccgttctctg       180
     gatggggata cgttaatcat ttacgataca tggacattaa gcagttgtat cgaagatgta       240
     gtccaaatgt ttagttgtct cctcaaaaac aataataccc tccattttgt caaaccgggc       300
     gtgataatcg accgcaaaag tgatacaatg gtcgttttag gtcttattga tcaactccgc       360
     cagatattgc aagacgatgc gaaaaaaggg attggacgtc cgcgaggatc aaaatcgtca       420
     tcaaaattcg atattcactt ggaacagatt atcgacttat tgaagaaacg gcgtagtgta       480
     agtgaaattg cacgggtgct ggacgtgagc cgaagctcgc tgaaagatta tattgaatca       540
     cgtgagctaa aagaggtcgt aaacggtgtc atcggtatcg gaaacgatga ggatgcggaa       600
     gcaacggtga tcgggacgat tcggtgcccg attgatgaat cacaaaaaag ggaaaatata       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page