(data stored in ACNUC7421 zone)

EMBL: CP002355.PE510

CP002355.PE510       Location/Qualifiers
FT   CDS_pept        complement(488931..489500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0387 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Aminotransferase
FT                   class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33178"
FT                   /db_xref="GOA:E4U013"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4U013"
FT                   /protein_id="ADR33178.1"
FT                   /translation="MLLETIRCEHKEAKHLPYHQKRLELACQALGITKRYDLKALITPP
FT                   DEKLYRCRFLYDQQGYSIEFHPYFPKKISSLKLITCDSLEYPLKYADREVLNALFELRA
FT                   ECDDVLIIKNGCLSDTTIANIALQIDGVWLTPDKPLLRGTTRARLIDEGFLTPAPLRPS
FT                   DIAKATKIALMNAMVGFIEVENGIIP"
     atgctgttag agaccattcg ctgcgaacat aaagaggcga agcacctccc ctatcaccaa        60
     aagcggttgg aactagcgtg ccaagcgctc ggaatcacga aacggtatga tttaaaggca       120
     ttaataacac ctcccgatga gaaactctac cgatgccgtt ttttgtatga tcagcagggg       180
     tattccatcg agtttcaccc ctattttccg aagaaaatat cctcgctcaa actcatcacc       240
     tgcgacagcc ttgagtatcc cctcaaatac gccgaccgcg aagttctcaa cgccctcttt       300
     gaattacgcg cagagtgtga cgatgtcctt atcatcaaaa acggctgcct gagcgatacg       360
     acgatcgcca atatcgcatt gcaaatcgat ggggtttggt taactcccga taagccttta       420
     ctcagaggaa caacacgagc cagattgatt gatgagggtt ttctgacacc ggcaccgctc       480
     agaccctctg atattgcaaa ggcgactaaa atagccctta tgaatgccat ggtaggattc       540
     attgaagtcg aaaatggtat aatcccttaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page